CATH Domain: 1wvfA02 XML data for domain: 1wvfA02

Molscript image for 1wvfA02
1wvfA02
PDB coordinates for domain 1wvfA02

PDB 1wvf, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.465 Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3
3.30.465.10 Gene3D
3.30.465.10.2
3.30.465.10.2.1
3.30.465.10.2.1.1
3.30.465.10.2.1.1.1
3.30.465.10.2.1.1.1.1

[top]
Segment boundaries for domain 1wvfA02

Chopping figure for domain 1wvfA02
DomainStart PDB ResidueStop PDB Residue
1wvfA01 7 114
1wvfA02 115 242
1wvfA03 243 473
1wvfA04 474 521

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.465.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2i0kA02 82.01 OxidoreductaseBrevibacterium sterolicum 3.30.465.10 126 6 84 2.44 2.89
1hskA01 79.92 Amino sugar and nucleotide sugar metabolismPeptidoglycan biosynthesisMetabolic pathwaysUDP-N-acetylmuramate dehydrogenase [EC:1.1.1.158]UDP-N-acetylenolpyruvoylglucosamine reductase 3.30.465.10 127 10 80 2.90 3.60
1uxyA03 75.66 Amino sugar and nucleotide sugar metabolismPeptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan biosynthetic processUDP-N-acetylmuramate dehydrogenase activity 3.30.465.10 150 10 69 2.93 4.23
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wvfA02
KIIKIDPEMCYALVEPGVTFGQMYDYIQENNLPVMLSFSAPSAIAGPVGNTMDRGVGYTPYGEHFMMQCGMEVVLANGDV
YRTGMGGVPGSNTWQIFKWGYGPTLDGMFTQANYGICTKMGFWLMPKP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wvfA02
KIIKIDPEMCYALVEPGVTFGQMYDYIQENNLPVMLSFSAPSAIAGPVGNTMDRGVGYTPYGEHFMMQCGMEVVLANGDV
YRTGMGGVPGSNTWQIFKWGYGPTLDGMFTQANYGICTKMGFWLMPKP
BLAST against CATH

[top]
Domain History Events (6)

Classification merge by cuff on 12 Nov 2010 19:26

COMMENT: merge superfamilies FINAL: merge superfamilies 3.30.465.20 --> 3.30.465.10

Domain assigned by auto on 28 Apr 2006 20:34

Assigning to "3.30.465.20" based on similarity with "1diqB03" (NWSI: 100, NWO: 100, SPS: 97.47, SPO: 100, RMSD: 0.55)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1wvfA02"

Flow stage update by auto on 28 Apr 2006 17:47

All required files are present for Domain "1wvfA02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1wvfA02"

Insertion by auto on 09 Mar 2006 22:46

Final ChopClose added based on similarity with "1wveB" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.83, SI: 100, SO: 100]