CATH Domain: 1wurA02

1wurA02

PDB 1wur, Chain A, Domain 2

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.1130	GTP Cyclohydrolase I, domain 2
3.30.1130.10		Gene3D
3.30.1130.10.2
3.30.1130.10.2.1
3.30.1130.10.2.1.1
3.30.1130.10.2.1.1.1
3.30.1130.10.2.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 1wurA02

Domain	Start PDB Residue	Stop PDB Residue
1wurA01	32	85
1wurA02	86	216

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.30.1130.10.2.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1dhnA00	83.16	Dihydroneopterin aldolase [EC:4.1.2.25]Folate biosynthesisDihydroneopterin aldolaseStaphylococcus aureusMetabolic pathways	3.30.1130.10	121	12	79	2.93	3.69
1nbuA00	82.56	Folate biosynthesisMetabolic pathwaysDihydroneopterin aldolase [EC:4.1.2.25]Mycobacterium tuberculosisProbable dihydroneopterin aldolase	3.30.1130.10	118	7	77	2.52	3.24
1b9lA00	80.58	Folic acid-containing compound metabolic processDihydroneopterin triphosphate 2'-epimerase activityD-erythro-7,8-dihydroneopterin triphosphate epimerase [EC:5.-.-.-]D-erythro-7,8-dihydroneopterin triphosphate epimeraseProtein binding	3.30.1130.10	119	5	77	2.64	3.42

[top]
Domain ATOM Sequence

>pdb|1wurA02
GAVFPAEGSEMVVVKGVEFYSMCEHHLLPFFGKVHIGYIPDGKILGLSKFARIVDMFARRLQVQERLAVQIAEAIQEVLE
PQGVGVVVEGVHLCMMMRGVEKQHSRTVTSAMLGVFRENQKTREEFLSHLR

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|1wurA02
GAVFPAEGSEMVVVKGVEFYSMCEHHLLPFFGKVHIGYIPDGKILGLSKFARIVDMFARRLQVQERLAVQIAEAIQEVLE
PQGVGVVVEGVHLCMMMRGVEKQHSRTVTSAMLGVFRENQKTREEFLSHLRDGTA

BLAST against CATH

[top]
Domain History Events (22)

Domain assigned by auto on 03 Nov 2006 13:59

Assigning to "3.30.1130.10" based on similarity with "1wurB02"

Flow stage update by auto on 03 Nov 2006 13:57

No in_process hits for Domain "1wurA02" ready to be processed

Update comment by auto on 03 Nov 2006 10:26

Domain "1wurA02" hits Domain "1wurB02" (100% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 06:12

Domain "1wurA02" hits Domain "1wurD02" (100% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 02:17

Domain "1wurA02" hits Domain "1wuqC02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 22:10

Domain "1wurA02" hits Domain "1wuqD02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 18:14

Domain "1wurA02" hits Domain "1wuqE02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 14:25

Domain "1wurA02" hits Domain "1wuqB02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 10:06

Domain "1wurA02" hits Domain "1wuqA02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "1wurA02" hits Domain "1wm9D02" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:16

Domain "1wurA02" hits Domain "1wm9E02" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "1wurA02" hits Domain "1wm9A02" (100% over 100%) which is currently in process