CATH Domain: 1wurA01

1wurA01

PDB 1wur, Chain A, Domain 1

CATH Code	Level Description	Links
1	Mainly Alpha
1.10	Orthogonal Bundle
1.10.286	GTP Cyclohydrolase I; Chain A, domain 1
1.10.286.10		Gene3D
1.10.286.10.2
1.10.286.10.2.1
1.10.286.10.2.1.1
1.10.286.10.2.1.1.1
1.10.286.10.2.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 1wurA01

Domain	Start PDB Residue	Stop PDB Residue
1wurA01	32	85
1wurA02	86	216

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.10.286.10.2.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1tfeA02	80.85	Thermus thermophilus HB8Elongation factor EF-TsElongation factor Ts	1.10.286.20	45	8	66	2.38	3.57
	1bh9A00	75.25	Basal transcription factorsTranscription factor TFIID complexTranscription initiation factor TFIID subunit D11Protein C-terminus bindingTranscription initiation factor TFIID subunit 13	1.10.20.10	45	13	72	2.98	4.13

[top]
Domain ATOM Sequence

>pdb|1wurA01
EVDLERLQALAAEWLQVIGEDPGREGLLKTPERVAKAWAFLTRGYRQRLEEVVG

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|1wurA01
EVDLERLQALAAEWLQVIGEDPGREGLLKTPERVAKAWAFLTRGYRQRLEEVVG

BLAST against CATH

[top]
Domain History Events (22)

Domain assigned by auto on 03 Nov 2006 13:59

Assigning to "1.10.286.10" based on similarity with "1wurB01"

Flow stage update by auto on 03 Nov 2006 13:57

No in_process hits for Domain "1wurA01" ready to be processed

Update comment by auto on 03 Nov 2006 10:26

Domain "1wurA01" hits Domain "1wurB01" (100% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 06:12

Domain "1wurA01" hits Domain "1wurD01" (100% over 100%) which is currently in process

Update comment by auto on 03 Nov 2006 02:17

Domain "1wurA01" hits Domain "1wuqC01" (100% over 98.1481481481482%) which is currently in process

Update comment by auto on 02 Nov 2006 22:10

Domain "1wurA01" hits Domain "1wuqD01" (100% over 98.1481481481482%) which is currently in process

Update comment by auto on 02 Nov 2006 18:14

Domain "1wurA01" hits Domain "1wuqE01" (100% over 98.1481481481482%) which is currently in process

Update comment by auto on 02 Nov 2006 14:25

Domain "1wurA01" hits Domain "1wuqB01" (100% over 98.1481481481482%) which is currently in process

Update comment by auto on 02 Nov 2006 10:06

Domain "1wurA01" hits Domain "1wuqA01" (100% over 98.1481481481482%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "1wurA01" hits Domain "1wm9D01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:16

Domain "1wurA01" hits Domain "1wm9E01" (100% over 98.1481481481482%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "1wurA01" hits Domain "1wm9A01" (100% over 100%) which is currently in process