CATH Domain: 1wu3I00 XML data for domain: 1wu3I00

Molscript image for 1wu3I00
1wu3I00
PDB coordinates for domain 1wu3I00

PDB 1wu3, Chain I, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1250 Growth Hormone; Chain: A;
1.20.1250.10 Gene3D
1.20.1250.10.17
1.20.1250.10.17.1
1.20.1250.10.17.1.1
1.20.1250.10.17.1.1.1
1.20.1250.10.17.1.1.1.1

[top]
Segment boundaries for domain 1wu3I00

Chopping figure for domain 1wu3I00
DomainStart PDB ResidueStop PDB Residue
1wu3I00 1 161

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3d48P00 82.05 Jak-STAT signaling pathwayPositive regulation of JAK-STAT cascadeRegulation of multicellular organism growthProlactin receptor bindingCell proliferation 1.20.1250.10 165 7 86 3.65 4.24
1evsA00 79.68 Jak-STAT signaling pathwayOncostatin-M receptor complexCytokine activityOncostatin MCell proliferation 1.20.1250.10 163 7 80 3.64 4.49
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wu3I00
INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIV
VRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQ
N
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wu3I00
INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIV
VRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQ
N
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Nov 2006 14:47

Assigning to "1.20.1250.10" based on similarity with "1au1A00"

Flow stage update by auto on 31 Oct 2006 05:52

No in_process hits for Domain "1wu3I00" ready to be processed

Flow stage update by auto on 31 Oct 2006 05:52

NW result present for Domain "1wu3I00"

Flow stage update by auto on 28 Oct 2006 13:45

All required files are present for Domain "1wu3I00"

Flow stage update by auto on 28 Oct 2006 01:49

Beginning processing for Domain "1wu3I00"

Insertion by cuff on 27 Oct 2006 16:38

selected batch of easy choppings.