Domain assigned by auto on 26 Apr 2009 07:01
Assigning to "1.10.10.10" based on similarity with "1mgtA02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1wrjA01 | 1 | 67 |
| 1wrjA02 | 68 | 150 |
There are 11 matching structural neighberhood comparisons for CATH ID 1.10.10.10.16.1.1.1.1 (SIMAX score < 5)
>pdb|1wrjA02 PFNEFRIRVFKEVMRIKWGEVRTYKQVADAVKTSPRAVGTALSKNNVLLIIPCHRVIGEKSLGGYSRGVELKRKLLELEG IDV
Assigning to "1.10.10.10" based on similarity with "1mgtA02"
No in_process hits for Domain "1wrjA02" ready to be processed
NW result present for Domain "1wrjA02"
All required files are present for Domain "1wrjA02"
Beginning processing for Domain "1wrjA02"
nice chopping