CATH Domain: 1wqkA00 XML data for domain: 1wqkA00

Molscript image for 1wqkA00
1wqkA00
PDB coordinates for domain 1wqkA00

PDB 1wqk, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.20 Anthopleurin-A
2.20.20.10 Anthopleurin-A Gene3D
2.20.20.10.5
2.20.20.10.5.1
2.20.20.10.5.1.1
2.20.20.10.5.1.1.1
2.20.20.10.5.1.1.1.1

[top]
Segment boundaries for domain 1wqkA00

Chopping figure for domain 1wqkA00
DomainStart PDB ResidueStop PDB Residue
1wqkA00 1 42

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.20.20.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ipxA01 80.67 RRNA processingCajal bodyRNA bindingHomo sapiensProtein binding 3.30.200.20 41 2 83 2.43 2.92
1fd3A00 80.30 Homo sapiensBeta-defensin 2Immune responseG-protein coupled receptor protein signaling pathwayChemotaxis 3.10.360.10 41 21 85 4.16 4.85
1sh1A00 79.75 Neurotoxin 1Stichodactyla helianthus 2.20.20.10 48 21 77 2.36 3.06
1g8aA01 79.40 Pyrococcus horikoshiiFibrillarin-like rRNA/tRNA 2'-O-methyltransferaseFibrillarin-like pre-rRNA processing protein 3.30.200.20 51 2 72 2.98 4.11
1k8bA00 73.45 Methanocaldococcus jannaschiiTranslation initiation factor 2 subunit betaTranslation initiation factor eIF-2 beta subunit 3.30.30.50 52 58 73 3.33 4.56
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wqkA00
GTTCYCGKTIGIYWFGTKTCPSNRGYTGSCGYFLGICCYPVD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wqkA00
GTTCYCGKTIGIYWFGTKTCPSNRGYTGSCGYFLGICCYPVD
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 20 Jul 2007 16:12

Assigning to "2.20.20.10" based on similarity with "1bds000"

Flow stage update by auto on 19 Jul 2007 22:49

No in_process hits for Domain "1wqkA00" ready to be processed

Flow stage update by auto on 19 Jul 2007 22:49

NW result present for Domain "1wqkA00"

Flow stage update by auto on 14 Jul 2007 06:01

All required files are present for Domain "1wqkA00"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "1wqkA00"

Insertion by auto on 13 Jul 2007 00:20

Final ChopClose added based on similarity with "1bds0"