CATH Domain: 1wqgA02 XML data for domain: 1wqgA02

Molscript image for 1wqgA02
1wqgA02
PDB coordinates for domain 1wqgA02

PDB 1wqg, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.40 Gene3D
3.30.1360.40.2
3.30.1360.40.2.1
3.30.1360.40.2.1.1
3.30.1360.40.2.1.1.1
3.30.1360.40.2.1.1.1.1

[top]
Segment boundaries for domain 1wqgA02

Chopping figure for domain 1wqgA02
DomainStart PDB ResidueStop PDB Residue
1wqgA01 2 30
1wqgA01 106 185
1wqgA02 31 105

Structural Neighbourhood (13 entries)

There are 13 matching structural neighberhood comparisons for CATH ID 3.30.1360.40.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 13 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wihA00 86.70 Mus musculusRibosome recycling factorRibosome-recycling factor, mitochondrialMitochondrion 3.30.1360.40 84 22 89 2.56 2.87
1b4bA00 81.46 Geobacillus stearothermophilusArginine repressor 3.30.1360.40 71 9 73 2.68 3.65
1xxaC00 80.75 Transcriptional regulator of arginine metabolismArginine repressorEscherichia coli K-12Plasmid recombination 3.30.1360.40 73 8 73 2.47 3.37
1u02A02 80.03 Trehalose-6-phosphate phosphatase related proteinThermoplasma acidophilum 3.30.70.1020 73 9 82 3.36 4.06
1s2oA02 79.80 Synechocystis sp. PCC 6803Slr0953 protein 3.90.1070.10 71 2 82 3.23 3.91
1uv7A00 79.22 Vibrio choleraeGeneral secretion pathway protein M 3.30.1360.100 74 16 85 3.28 3.84
1wr8A02 78.74 Pyrococcus horikoshiiPhosphoglycolate phosphatase 3.90.1070.10 69 13 76 3.11 4.09
1in0A01 78.51 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 7 77 3.27 4.23
1cvjA01 77.87 Poly(A) RNA bindingTranslation activator activityProtein C-terminus bindingMRNA polyadenylationPolyadenylate-binding protein 1 3.30.70.330 77 8 74 2.68 3.62
2kt2A00 77.62 Mercuric reductasePseudomonas aeruginosaMercuric reductase [EC:1.16.1.1] 3.30.70.100 69 8 72 3.56 4.94
2phcB01 77.50 Pyrococcus horikoshiiPutative uncharacterized protein PH0987 3.30.1360.40 83 8 60 2.37 3.93
1l6rA02 76.09 Thermoplasma acidophilumPhosphoglycolate phosphatase 3.90.1070.10 63 7 76 3.62 4.76
3bp8C00 75.95 Amino sugar and nucleotide sugar metabolismPhosphotransferase system (PTS)Glycolysis / GluconeogenesisPTS system glucose-specific EIICB componentPTS system, glucose-specific IIB component [EC:2.7.1.69] 3.30.1360.60 75 2 81 3.44 4.23
[1]
Displaying entries 1 to 13 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wqgA02
RANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wqgA02
RANPGMFSRITIDYYGAATPITQLASINVPEARLVVIKPYEANQLRAIETAIRNSDLGVNPTNDGALIRVAVPQL
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 05 Nov 2006 05:25

Assigning to "3.30.1360.40" based on similarity with "1wqfA02"

Flow stage update by auto on 05 Nov 2006 05:23

No in_process hits for Domain "1wqgA02" ready to be processed

Update comment by auto on 05 Nov 2006 01:35

Domain "1wqgA02" hits Domain "1wqfA02" (100% over 100%) which is currently in process

Flow stage update by auto on 05 Nov 2006 01:32

Domain "1wqgA02" hits Domain "1wqfA02" (100% over 100%) which is currently in process

Flow stage update by auto on 05 Nov 2006 01:32

NW result present for Domain "1wqgA02"

Flow stage update by auto on 02 Nov 2006 14:22

All required files are present for Domain "1wqgA02"

Flow stage update by auto on 01 Nov 2006 21:55

Beginning processing for Domain "1wqgA02"

Insertion by auto on 01 Nov 2006 21:20

Final ChopClose added based on similarity with "1wqfA"