Domain assigned by auto on 26 Apr 2009 04:10
Assigning to "3.40.120.10" based on similarity with "1k2yX01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1wqaA01 | 1 | 152 |
| 1wqaA02 | 153 | 256 |
| 1wqaA02 | 341 | 358 |
| 1wqaA03 | 257 | 340 |
| 1wqaA03 | 359 | 370 |
| 1wqaA04 | 371 | 455 |
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.120.10.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2fuvA01 | 83.29 | 3.40.120.10 | 204 | 32 | 74 | 3.16 | 4.27 | |
![]() |
3pmgA01 | 82.50 | 3.40.120.10 | 196 | 19 | 77 | 2.71 | 3.52 |
>pdb|1wqaA01 MGKLFGTFGVRGIANEKITPEFAMKIGMAFGTLLKREGRKKPLVVVGRDTRVSGEMLKEALISGLLSVGCDVIDVGIAPT PAVQWATKHFNADGGAVITASHNPPEYNGIKLLEPNGMGLKKEREAIVEELFFKEDFDRAKWYEIGEVRRED
Assigning to "3.40.120.10" based on similarity with "1k2yX01"
No in_process hits for Domain "1wqaA01" ready to be processed
NW result present for Domain "1wqaA01"
All required files are present for Domain "1wqaA01"
Beginning processing for Domain "1wqaA01"
nice chopping