Set cath from cathlist by auto on 05 Mar 2006 18:47
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
CATH Domain: 1wpgB01
1wpgB01
PDB 1wpg, Chain B, Domain 1
Segment boundaries for domain 1wpgB01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1wpgB01 | 12 | 55 |
| 1wpgB01 | 113 | 240 |
| 1wpgB02 | 56 | 112 |
| 1wpgB02 | 241 | 345 |
| 1wpgB02 | 746 | 994 |
| 1wpgB03 | 359 | 602 |
| 1wpgB04 | 346 | 358 |
| 1wpgB04 | 603 | 745 |
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 2.70.150.10.1.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
2zxeA01 | 88.93 | 2.70.150.10 | 166 | 30 | 84 | 1.48 | 1.74 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|1wpgB01 CLAYFGVSETTGLTPDQVKRHLEKYGHNELPAEEGKSLWELVIEENAIEALKEYEPEMGKVYRADRKSVQRIKARDIVPG DIVEVAVGDKVPADIRILSIKSTTLRVDQSILTGESVSVIKHTEPVPDPRAVNQDKKNMLFSGTNIAAGKALGIVATTGV STEIGKIRDQMA
Domain History Events (3)
Flow stage update by auto on 05 Mar 2006 18:47
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
Insertion by auto on 05 Mar 2006 17:51
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"
