CATH Domain: 1woqA02 XML data for domain: 1woqA02

Molscript image for 1woqA02
1woqA02
PDB coordinates for domain 1woqA02

PDB 1woq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.5
3.30.420.40.5.1
3.30.420.40.5.1.1
3.30.420.40.5.1.1.1
3.30.420.40.5.1.1.1.1

[top]
Segment boundaries for domain 1woqA02

Chopping figure for domain 1woqA02
DomainStart PDB ResidueStop PDB Residue
1woqA01 11 122
1woqA02 123 263

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.30.420.40.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3epqA02 84.78 3.30.420.40 177 29 74 2.14 2.89
2gupA02 83.07 ROK family proteinStreptococcus pneumoniae 3.30.420.40 187 21 72 2.18 3.02
2hoeA03 80.69 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 143 13 74 2.59 3.49
1z05A03 80.38 Vibrio choleraeTranscriptional regulator, ROK family 3.30.420.40 170 19 63 2.12 3.34
2ap1A02 80.10 Amino sugar and nucleotide sugar metabolismN-acetylglucosamine kinase [EC:2.7.1.59]Salmonella enterica subsp. enterica serovar TyphimuriumN-acetyl-D-glucosamine kinase 3.30.420.40 162 17 63 1.88 2.96
2qm1A02 78.71 Amino sugar and nucleotide sugar metabolismGalactose metabolismGlucokinase [EC:2.7.1.2]Enterococcus faecalisMetabolic pathways 3.30.420.40 172 21 61 2.28 3.70
1sz2A02 75.82 Galactose metabolismAmino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismGlycolysis / Gluconeogenesis 3.40.367.20 197 14 60 3.01 4.98
2nrhA02 75.40 Type III pantothenate kinaseType III pantothenate kinase [EC:2.7.1.33]Pantothenate and CoA biosynthesisMetabolic pathwaysCampylobacter jejuni RM1221 3.30.420.40 141 8 74 3.70 4.97
2gelA02 74.36 Putative molecular chaperoneSalmonella enterica subsp. enterica serovar Typhimurium 3.30.420.40 95 5 63 2.88 4.56
3h1qA02 73.83 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 10 60 2.74 4.55
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1woqA02
DADAAGLAEARYGAGAGVKGTVLVITLGTGIGSAFIFDGKLVPNAELGHLEIDGHDAETKASAVARERDGLSWDEYSVLL
QRYFSHVEFLFSPELFIVGGGISKRADEYLPNLRLRTPIVPAVLRNEAGIVGAAIEIALQH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1woqA02
DADAAGLAEARYGAGAGVKGTVLVITLGTGIGSAFIFDGKLVPNAELGHLEIDGHDAETKASAVARERDGLSWDEYSVLL
QRYFSHVEFLFSPELFIVGGGISKRADEYLPNLRLRTPIVPAVLRNEAGIVGAAIEIALQHKLAK
BLAST against CATH

[top]
Domain History Events (4)

Classification merge by cuff on 12 Nov 2010 19:26

COMMENT: merging superfamily FINAL: merge 3.30.420.160 --> 3.30.420.40

Insertion by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Flow stage update by sillitoe on 06 Mar 2006 15:33

HomCheck 'Assigned T' domains

Insertion by auto on 06 Mar 2006 00:15

Cut based on decision in database "DomChop" on "cathdb"