CATH Domain: 1woqA01 XML data for domain: 1woqA01

Molscript image for 1woqA01
1woqA01
PDB coordinates for domain 1woqA01

PDB 1woq, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.40 Gene3D
3.30.420.40.17
3.30.420.40.17.1
3.30.420.40.17.1.1
3.30.420.40.17.1.1.1
3.30.420.40.17.1.1.1.1

[top]
Segment boundaries for domain 1woqA01

Chopping figure for domain 1woqA01
DomainStart PDB ResidueStop PDB Residue
1woqA01 11 122
1woqA02 123 263

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.30.420.40.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1e4fT04 80.84 Thermotoga maritimaCell division protein FtsA, putativeCell division protein FtsA 3.30.420.40 89 14 74 2.60 3.51
2hoeA02 80.83 Thermotoga maritimaTranscriptional regulator, XylR-related 3.30.420.40 146 19 71 2.66 3.70
2gupA01 80.78 ROK family proteinStreptococcus pneumoniae 3.30.420.40 96 25 83 2.86 3.41
1jcfA02 80.49 Thermotoga maritimaRod shape-determining protein MreB and related proteinsRod shape-determining protein MreB 3.30.420.40 89 15 74 3.17 4.28
1sz2B01 80.11 Galactose metabolismAmino sugar and nucleotide sugar metabolismMetabolic pathwaysStarch and sucrose metabolismGlycolysis / Gluconeogenesis 3.30.420.40 118 15 80 3.47 4.31
3epqA01 79.50 3.30.420.40 91 19 76 2.81 3.66
3h1qA02 77.84 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 113 16 73 2.78 3.78
3cerC01 76.69 Possible exopolyphosphatase-like proteinBifidobacterium longum 3.30.420.40 127 15 74 3.61 4.83
2qxlB01 76.57 ATP bindingCytoplasmAdenyl-nucleotide exchange factor activityHeat shock protein homolog SSE1Peptide binding 3.30.420.40 134 10 67 3.02 4.50
1czaN03 75.39 Type II diabetes mellitusGalactose metabolismAmino sugar and nucleotide sugar metabolismButirosin and neomycin biosynthesisHexokinase [EC:2.7.1.1] 3.30.420.40 178 17 61 2.57 4.16
3h1qA01 75.30 Ethanolamine utilization protein EutJCarboxydothermus hydrogenoformans Z-2901Ethanolamine utilization protein EutJ 3.30.420.40 152 8 60 2.78 4.59
1huxA02 75.26 Activator of (R)-2-hydroxyglutaryl-CoA dehydrataseAcidaminococcus fermentans DSM 20731 3.30.420.40 140 15 57 2.74 4.79
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1woqA01
NAPLIGIDIGGTGIKGGIVDLKKGKLLGERFRVPTPQPATPESVAEAVALVVAELSARPEAPAAGSPVGVTFPGIIQHGV
VHSAANVDKSWLNTDIDALLTARLGRPVEVIN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1woqA01
MAKKDEKSHKNAPLIGIDIGGTGIKGGIVDLKKGKLLGERFRVPTPQPATPESVAEAVALVVAELSARPEAPAAGSPVGV
TFPGIIQHGVVHSAANVDKSWLNTDIDALLTARLGRPVEVIN
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:15

Cut based on decision in database "DomChop" on "cathdb"