Domain assigned by auto on 28 Apr 2006 19:46
Assigning to "2.40.50.140" based on similarity with "1wocD00" (NWSI: 98.0582524271845, NWO: 100, SPS: 95.01, SPO: 98, RMSD: 1.00)
There are 32 matching structural neighberhood comparisons for CATH ID 2.40.50.140.15.1.1.1.1 (SIMAX score < 5)
>pdb|1wocC00 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQPVIVSGHENQAITHSITVGSRITVQGFISCHK AKNGLSKVLHAEQIELID
Assigning to "2.40.50.140" based on similarity with "1wocD00" (NWSI: 98.0582524271845, NWO: 100, SPS: 95.01, SPO: 98, RMSD: 1.00)
NW result present for Domain "1wocC00"
All required files are present for Domain "1wocC00"
Beginning processing for Domain "1wocC00"
Cut based on decision in database "DomChop" on "cathdb"