CATH Domain: 1wo8A00 XML data for domain: 1wo8A00

Molscript image for 1wo8A00
1wo8A00
PDB coordinates for domain 1wo8A00

PDB 1wo8, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1380 Gene3D
3.40.50.1380.3
3.40.50.1380.3.1
3.40.50.1380.3.1.1
3.40.50.1380.3.1.1.1
3.40.50.1380.3.1.1.1.1

[top]
Segment boundaries for domain 1wo8A00

Chopping figure for domain 1wo8A00
DomainStart PDB ResidueStop PDB Residue
1wo8A00 1 126

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.40.50.1380.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1c30A08 84.14 3.40.50.1380 137 16 86 3.48 4.01
1a9xA08 83.44 3.40.50.1380 106 17 80 2.93 3.66
1srrC00 76.83 Sporulation initiation phosphotransferase FTwo-component system, response regulator, stage 0 sporulation protein FBacillus subtilisTwo-component system 3.40.50.2300 121 5 73 3.57 4.84
2b4aA00 75.73 BH3024 proteinBacillus halodurans 3.40.50.2300 116 6 73 3.42 4.68
1wcwA02 74.80 Thermus thermophilus HB8Uroporphyrinogen-III synthase [EC:4.2.1.75]Probable uroporphyrinogen-III synthasePorphyrin and chlorophyll metabolismMetabolic pathways 3.40.50.10090 119 10 77 3.61 4.64
1gntA04 74.36 Hydroxylamine reductaseHydroxylamine reductase [EC:1.7.-.-]Desulfovibrio vulgaris str. Hildenborough 3.40.50.2030 173 8 63 3.09 4.90
2js7A01 74.08 Myeloid differentiation primary response protein MyD88Response to interleukin-1Death receptor bindingHomo sapiensCell surface receptor linked signaling pathway 3.40.50.10140 136 6 76 3.78 4.94
2wi8A01 73.33 Bacillus subtilisIron complex transport system substrate-binding proteinIron-uptake system-binding proteinABC transporters 3.40.50.1980 126 8 79 3.77 4.75
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wo8A00
MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQ
DPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wo8A00
MKALALIAHDAKKDEMVAFCLRHKDVLARYPLLATGTTGARIQEATGLAVERVLSGPLGGDLQIGARVAEGKVLAVVFLQ
DPLTAKPHEPDVQALMRVCNVHGVPLATNLVAAEALIAWIRKGTPQ
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 05 Nov 2006 21:22

Assigning to "3.40.50.1380" based on similarity with "1wo8B00"

Flow stage update by auto on 05 Nov 2006 21:21

No in_process hits for Domain "1wo8A00" ready to be processed

Update comment by auto on 05 Nov 2006 17:22

Domain "1wo8A00" hits Domain "1wo8B00" (100% over 100%) which is currently in process

Update comment by auto on 05 Nov 2006 13:26

Domain "1wo8A00" hits Domain "1wo8F00" (100% over 100%) which is currently in process

Update comment by auto on 05 Nov 2006 09:23

Domain "1wo8A00" hits Domain "1wo8C00" (100% over 100%) which is currently in process

Update comment by auto on 05 Nov 2006 05:23

Domain "1wo8A00" hits Domain "1wo8E00" (100% over 100%) which is currently in process

Update comment by auto on 05 Nov 2006 01:35

Domain "1wo8A00" hits Domain "1wo8D00" (100% over 100%) which is currently in process

Flow stage update by auto on 05 Nov 2006 01:32

Domain "1wo8A00" hits Domain "1wo8D00" (100% over 100%) which is currently in process

Flow stage update by auto on 05 Nov 2006 01:32

NW result present for Domain "1wo8A00"

Flow stage update by auto on 02 Nov 2006 14:22

All required files are present for Domain "1wo8A00"

Flow stage update by auto on 01 Nov 2006 18:02

Beginning processing for Domain "1wo8A00"

Insertion by auto on 01 Nov 2006 17:27

Final ChopClose added based on similarity with "1wo8B"