CATH Domain: 1wnyA00 XML data for domain: 1wnyA00

Molscript image for 1wnyA00
1wnyA00
PDB coordinates for domain 1wnyA00

PDB 1wny, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.740 Isoleucyl-tRNA Synthetase; domain 2
3.90.740.10 Isoleucyl-tRNA Synthetase; Domain 2 Gene3D
3.90.740.10.1
3.90.740.10.1.1
3.90.740.10.1.1.1
3.90.740.10.1.1.1.1
3.90.740.10.1.1.1.1.1

[top]
Segment boundaries for domain 1wnyA00

Chopping figure for domain 1wnyA00
DomainStart PDB ResidueStop PDB Residue
1wnyA00 202 381

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.90.740.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wkaA00 85.38 Aminoacyl-tRNA biosynthesisValyl-tRNA synthetase [EC:6.1.1.9]Valyl-tRNA synthetaseValine, leucine and isoleucine biosynthesisThermus thermophilus 3.90.740.10 143 26 76 2.03 2.65
2ajgA00 82.00 Aminoacyl-tRNA biosynthesisValine, leucine and isoleucine biosynthesisLeucyl-tRNA synthetase [EC:6.1.1.4]Leucine-tRNA ligase activityLeucyl-tRNA aminoacylation 3.90.740.10 186 21 76 2.96 3.88
1wkbA02 81.25 Leucyl-tRNA synthetase [EC:6.1.1.4]Aminoacyl-tRNA biosynthesisPyrococcus horikoshiiLeucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 3.90.740.10 227 21 75 2.45 3.23
1qu3A02 80.11 Aminoacyl-tRNA biosynthesisIsoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseStaphylococcus aureusValine, leucine and isoleucine biosynthesis 3.90.740.10 192 32 92 2.64 2.86
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wnyA00
DPSVYVRFPLKEPKKLGLEKASLLIWTTTPWTLPGNVAAAVHPEYTYAAFQVGDEALILEEGLGRKLLGEGTPVLKTFPG
KALEGLPYTPPYPQALEKGYFVVLADYVSQEDGTGIVHQAPAFGAEDLETARVYGLPLLKTVDEEGKLLVEPFKGLYFRE
ANRAILRDLRGRGLLFKEES
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wnyA00
MQDPSVYVRFPLKEPKKLGLEKASLLIWTTTPWTLPGNVAAAVHPEYTYAAFQVGDEALILEEGLGRKLLGEGTPVLKTF
PGKALEGLPYTPPYPQALEKGYFVVLADYVSQEDGTGIVHQAPAFGAEDLETARVYGLPLLKTVDEEGKLLVEPFKGLYF
REANRAILRDLRGRGLLFKEESYLHS
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:45

Assigning to "3.90.740.10" based on similarity with "1wnzA00" (NWSI: 100, NWO: 100, SPS: 98.05, SPO: 100, RMSD: 0.36)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1wnyA00"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1wnyA00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1wnyA00"

Insertion by auto on 09 Mar 2006 13:24

Final ChopClose added based on similarity with "1udzA" [LEE: 1, LME: 0, MR: 0, LG: 1, SS: 98.58, SI: 99.4505494505494, SO: 97.8494623655914]