CATH Domain: 1wndA02 XML data for domain: 1wndA02

Molscript image for 1wndA02
1wndA02
PDB coordinates for domain 1wndA02

PDB 1wnd, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.309 Aldehyde Dehydrogenase; Chain A, domain 2
3.40.309.10 Aldehyde Dehydrogenase; Chain A, domain 2 Gene3D
3.40.309.10.6
3.40.309.10.6.1
3.40.309.10.6.1.1
3.40.309.10.6.1.1.1
3.40.309.10.6.1.1.1.1

[top]
Segment boundaries for domain 1wndA02

Chopping figure for domain 1wndA02
DomainStart PDB ResidueStop PDB Residue
1wndA01 1 248
1wndA01 440 474
1wndA02 249 439

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.309.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1t90A02 90.95 Methylmalonate semialdehyde dehydrogenase [acylating]Bacillus subtilisMethylmalonate-semialdehyde dehydrogenase [EC:1.2.1.27]Valine, leucine and isoleucine degradationPropanoate metabolism 3.40.309.10 199 24 95 1.46 1.53
1ad3A02 87.56 Tyrosine metabolismRattus norvegicusResponse to glucocorticoid stimulus3-chloroallyl aldehyde dehydrogenase activityCytosol 3.40.309.10 195 23 91 1.80 1.97
1ez0A02 86.06 NADP-dependent fatty aldehyde dehydrogenaseVibrio harveyi 3.40.309.10 185 14 91 2.26 2.47
1o20A02 83.58 Thermotoga maritimaGamma-glutamyl phosphate reductaseArginine and proline metabolismGlutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]Metabolic pathways 3.40.309.10 149 11 71 2.22 3.10
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wndA02
GKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDESTELGPLSSLAHL
ERVGKAVEEAKATGHIKVITGGEKRKGNGYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLAS
SVWTKDVGRAHRVSARLQYGCTWVNTHFMLV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wndA02
GKAPVIVFDDADIEAVVEGVRTFGYYNAGQDCTAACRIYAQKGIYDTLVEKLGAAVATLKSGAPDDESTELGPLSSLAHL
ERVGKAVEEAKATGHIKVITGGEKRKGNGYYYAPTLLAGALQDDAIVQKEVFGPVVSVTPFDNEEQVVNWANDSQYGLAS
SVWTKDVGRAHRVSARLQYGCTWVNTHFMLV
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:14

Cut based on decision in database "DomChop" on "cathdb"