CATH Domain: 1wmgA00 XML data for domain: 1wmgA00

Molscript image for 1wmgA00
1wmgA00
PDB coordinates for domain 1wmgA00

PDB 1wmg, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.533 Death Domain, Fas
1.10.533.10 Death Domain, Fas Gene3D
1.10.533.10.3
1.10.533.10.3.1
1.10.533.10.3.1.1
1.10.533.10.3.1.1.1
1.10.533.10.3.1.1.1.1

[top]
Segment boundaries for domain 1wmgA00

Chopping figure for domain 1wmgA00
DomainStart PDB ResidueStop PDB Residue
1wmgA00 854 943

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 1.10.533.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ngrA00 81.94 Negative regulation of muscle organ developmentRattus norvegicusNucleusNeurotrophin signaling pathwayTumor necrosis factor receptor superfamily member 16 1.10.533.10 85 22 88 3.29 3.72
1ichA00 81.88 Integral to plasma membraneChagas diseaseTumor necrosis factor receptor superfamily member 1AAlzheimer's diseasePositive regulation of I-kappaB kinase/NF-kappaB cascade 1.10.533.10 87 11 86 3.46 4.01
3ezqB00 81.31 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 99 16 78 3.29 4.18
1dgnA00 80.14 Caspase recruitment domain-containing protein 18NOD-like receptor signaling pathwayCaspase recruitment domain-containing protein 18Homo sapiens 1.10.533.10 89 11 84 3.28 3.89
1a1wA00 78.27 FAS (TNFRSF6)-associated via death domainIdentical protein bindingPathways in cancerChagas diseaseAlzheimer's disease 1.10.533.10 83 13 87 4.02 4.61
3ygsP00 78.20 Pathways in cancerActivation of caspase activity by cytochrome cEnzyme activator activityNon-small cell lung cancerAlzheimer's disease 1.10.533.10 97 15 78 3.17 4.05
1pn5A00 76.22 Protein domain specific bindingStreptococcus sp. 'group G'ATP bindingEnzyme bindingHomo sapiens 1.10.533.10 93 6 76 3.53 4.62
1ucpA00 75.60 Protein homodimerization activityApoptosis-associated speck-like protein containing a CARDPositive regulation of interleukin-1 beta secretionPyrin domain bindingTumor necrosis factor-mediated signaling pathway 1.10.533.10 91 8 86 3.51 4.04
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wmgA00
YAFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASALEEGKSEL
VAATDG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wmgA00
GSSGSSGYAFKIPLSIRQKICSSLDAPNSRGNDWRLLAQKLSXDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASA
LEEXGKSEXLVAXATDGSGPSSG
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:35

Assigning to "1.10.533.10" based on similarity with "1wmgF00" (NWSI: 96.1165048543689, NWO: 100, SPS: 91.13, SPO: 96, RMSD: 2.00)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1wmgA00"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1wmgA00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1wmgA00"

Insertion by auto on 09 Mar 2006 11:24

Final ChopClose added based on similarity with "1wmgB" [LEE: 2, LME: 0, MR: 0, LG: 4, SS: 95.37, SI: 96.1165048543689, SO: 100]