CATH Domain: 1wkbA03 XML data for domain: 1wkbA03

Molscript image for 1wkbA03
1wkbA03
PDB coordinates for domain 1wkbA03

PDB 1wkb, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.730 Isoleucyl-tRNA Synthetase; Domain 1
1.10.730.10 Isoleucyl-tRNA Synthetase; Domain 1 Gene3D
1.10.730.10.5
1.10.730.10.5.1
1.10.730.10.5.1.1
1.10.730.10.5.1.1.1
1.10.730.10.5.1.1.1.1

[top]
Segment boundaries for domain 1wkbA03

Chopping figure for domain 1wkbA03
DomainStart PDB ResidueStop PDB Residue
1wkbA01 4 204
1wkbA01 448 689
1wkbA02 205 447
1wkbA03 690 810

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.10.730.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rqgA04 83.44 Aminoacyl-tRNA biosynthesisSelenoamino acid metabolismPyrococcus abyssiMethionyl-tRNA synthetaseMethionyl-tRNA synthetase [EC:6.1.1.10] 1.10.730.10 151 17 72 2.04 2.83
1qu3A04 83.44 Aminoacyl-tRNA biosynthesisIsoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseStaphylococcus aureusValine, leucine and isoleucine biosynthesis 1.10.730.10 150 22 80 2.05 2.54
1f7uA02 80.60 Aminoacyl-tRNA biosynthesisArginyl-tRNA synthetase, cytoplasmicArginine-tRNA ligase activityArginyl-tRNA synthetase [EC:6.1.1.19]Arginyl-tRNA aminoacylation 1.10.730.10 125 8 88 3.74 4.25
1ileA03 80.05 Aminoacyl-tRNA biosynthesisThermus thermophilus HB8Isoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 1.10.730.10 191 29 63 2.24 3.54
1gaxA02 77.10 Aminoacyl-tRNA biosynthesisValyl-tRNA synthetase [EC:6.1.1.9]Valyl-tRNA synthetaseValine, leucine and isoleucine biosynthesisThermus thermophilus 1.10.730.10 227 18 53 2.53 4.75
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wkbA03
RRKEVGKLRKQIERFYELISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLR
RTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wkbA03
RRKEVGKLRKQIERFYELISQFAEYEVKGNVELKDIDRWMLHRLNKAIKETTNALEEFRTRTAVQWAFYSIMNDLRWYLR
RTEGRDDEAKRYVLRTLADVWVRLMAPFTPHICEELWEKLG
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:14

Cut based on decision in database "DomChop" on "cathdb"