CATH Domain: 1wkaA00 XML data for domain: 1wkaA00

Molscript image for 1wkaA00
1wkaA00
PDB coordinates for domain 1wkaA00

PDB 1wka, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.740 Isoleucyl-tRNA Synthetase; domain 2
3.90.740.10 Isoleucyl-tRNA Synthetase; Domain 2 Gene3D
3.90.740.10.3
3.90.740.10.3.1
3.90.740.10.3.1.1
3.90.740.10.3.1.1.1
3.90.740.10.3.1.1.1.1

[top]
Segment boundaries for domain 1wkaA00

Chopping figure for domain 1wkaA00
DomainStart PDB ResidueStop PDB Residue
1wkaA00 195 337

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.90.740.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1wkbA02 79.30 Leucyl-tRNA synthetase [EC:6.1.1.4]Aminoacyl-tRNA biosynthesisPyrococcus horikoshiiLeucyl-tRNA synthetaseValine, leucine and isoleucine biosynthesis 3.90.740.10 227 22 61 2.50 4.08
1qu3A02 75.93 Aminoacyl-tRNA biosynthesisIsoleucyl-tRNA synthetase [EC:6.1.1.5]Isoleucyl-tRNA synthetaseStaphylococcus aureusValine, leucine and isoleucine biosynthesis 3.90.740.10 192 25 72 2.33 3.20
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wkaA00
GKLYTLRYEVEGGGFIEIATVRPETVFADQAIAVHPEDERYRHLLGKRARIPLTEVWIPILADPAVEKDFGTGALKVTPA
HDPLDYEIGERHGLKPVSVINLEGRMEGERVPEALRGLDRFEARRKAVELFREAGHLVKEEDY
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wkaA00
MTPGKLYTLRYEVEGGGFIEIATVRPETVFADQAIAVHPEDERYRHLLGKRARIPLTEVWIPILADPAVEKDFGTGALKV
TPAHDPLDYEIGERHGLKPVSVINLEGRMEGERVPEALRGLDRFEARRKAVELFREAGHLVKEEDYT
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 27 Jun 2007 22:07

Assigning to "3.90.740.10" based on similarity with "1gaxA03"

Flow stage update by auto on 14 May 2007 02:14

No in_process hits for Domain "1wkaA00" ready to be processed

Flow stage update by auto on 14 May 2007 02:13

NW result present for Domain "1wkaA00"

Flow stage update by auto on 10 May 2007 21:59

All required files are present for Domain "1wkaA00"

Flow stage update by auto on 10 May 2007 14:08

Beginning processing for Domain "1wkaA00"

Insertion by auto on 10 May 2007 13:59

Final ChopClose added based on similarity with "1wk9A"