CATH Domain: 1wgtA04 XML data for domain: 1wgtA04

Molscript image for 1wgtA04
1wgtA04
PDB coordinates for domain 1wgtA04

PDB 1wgt, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.60 Wheat Germ Agglutinin (Isolectin 2); domain 1
3.30.60.10 Gene3D
3.30.60.10.3
3.30.60.10.3.1
3.30.60.10.3.1.1
3.30.60.10.3.1.1.1
3.30.60.10.3.1.1.1.1

[top]
Segment boundaries for domain 1wgtA04

Chopping figure for domain 1wgtA04
DomainStart PDB ResidueStop PDB Residue
1wgtA01 2 42
1wgtA02 43 85
1wgtA03 86 128
1wgtA04 129 171

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.60.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2uzyB02 71.79 Basal plasma membraneHepatocyte growth factor receptor activityEpithelial cell signaling in Helicobacter pylori infectionPathways in cancerProto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1] 3.30.1680.10 45 2 88 4.43 4.98
1p0t100 71.79 Tumor necrosis factor receptor superfamily member 13CTumor necrosis factor receptor superfamily, member 13CCytokine-cytokine receptor interactionIntestinal immune network for IgA productionPrimary immunodeficiency 2.10.50.10 24 12 53 2.60 4.86
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1wgtA04
DKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wgtA04
DKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIATNSTLLAE
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 18:58

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 18:58

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:51

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"