CATH Domain: 1wevA01 XML data for domain: 1wevA01

Molscript image for 1wevA01
1wevA01
PDB coordinates for domain 1wevA01

PDB 1wev, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.40 Herpes Virus-1
3.30.40.10 Zinc/RING finger domain, C3HC4 (zinc finger) Gene3D
3.30.40.10.17
3.30.40.10.17.1
3.30.40.10.17.1.1
3.30.40.10.17.1.1.1
3.30.40.10.17.1.1.1.1

[top]
Segment boundaries for domain 1wevA01

Chopping figure for domain 1wevA01
DomainStart PDB ResidueStop PDB Residue
1wevA01 11 74

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1wevA01
FAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1wevA01
FAMEMGLACVVCRQMTVASGNQLVECQECHNLYHQDCHKPQVTDKEVNDPRLVWYCARCTRQMK
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 03 Mar 2009 21:18

Assigning to "3.30.40.10" based on similarity with "2puyA00"

Flow stage update by auto on 03 Mar 2009 20:57

No in_process hits for Domain "1wevA01" ready to be processed

Flow stage update by auto on 03 Mar 2009 20:57

NW result present for Domain "1wevA01"

Flow stage update by auto on 03 Mar 2009 20:57

All required files are present for Domain "1wevA01"

Flow stage update by auto on 03 Mar 2009 20:57

Beginning processing for Domain "1wevA01"

Insertion by cuff on 02 Mar 2009 19:00

nice chopping