CATH Domain: 1w9pA02 XML data for domain: 1w9pA02

Molscript image for 1w9pA02
1w9pA02
PDB coordinates for domain 1w9pA02

PDB 1w9p, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.50 Chitinase A; domain 3
3.10.50.10 Gene3D
3.10.50.10.4
3.10.50.10.4.2
3.10.50.10.4.2.1
3.10.50.10.4.2.1.1
3.10.50.10.4.2.1.1.1

Segment boundaries for domain 1w9pA02

Chopping figure for domain 1w9pA02
DomainStart PDB ResidueStop PDB Residue
1w9pA01 39 297
1w9pA01 361 433
1w9pA02 298 360

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.10.50.10.4.2.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1kfwA02 91.39 ChitinaseArthrobacter sp. 3.10.50.10 63 30 95 1.50 1.57
1jndA02 78.81 Amino sugar and nucleotide sugar metabolismChitinase [EC:3.2.1.14]Imaginal disc developmentChitinase-like protein Idgf2Imaginal disc growth factor receptor binding 3.10.50.10 94 20 67 2.26 3.37
Displaying entries 1 to 2 (page 1 of 1)


Domain ATOM Sequence

>pdb|1w9pA02
LYGRSFANTDGPGKPYNGVGQGSWENGVWDYKALPQAGATEHVLPDIMASYSYDATNKFLISY    

Domain COMBS Sequence

>pdb|1w9pA02
LYGRSFANTDGPGKPYNGVGQGSWENGVWDYKALPQAGATEHVLPDIMASYSYDATNKFLISY    

Domain History Events (6)

Domain assigned by auto on 04 Nov 2006 21:27

Assigning to "3.10.50.10" based on similarity with "1d2kA02"

Flow stage update by auto on 04 Nov 2006 21:24

No in_process hits for Domain "1w9pA02" ready to be processed

Flow stage update by auto on 04 Nov 2006 21:24

NW result present for Domain "1w9pA02"

Flow stage update by auto on 02 Nov 2006 14:22

All required files are present for Domain "1w9pA02"

Flow stage update by auto on 01 Nov 2006 21:55

Beginning processing for Domain "1w9pA02"

Insertion by auto on 01 Nov 2006 21:20

Final ChopClose added based on similarity with "1wnoA"