CATH Domain: 1w96A03 XML data for domain: 1w96A03

Molscript image for 1w96A03
1w96A03
PDB coordinates for domain 1w96A03

PDB 1w96, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.8
3.30.1490.20.8.1
3.30.1490.20.8.1.1
3.30.1490.20.8.1.1.1
3.30.1490.20.8.1.1.1.1

[top]
Segment boundaries for domain 1w96A03

Chopping figure for domain 1w96A03
DomainStart PDB ResidueStop PDB Residue
1w96A01 14 185
1w96A02 186 230
1w96A03 231 293
1w96A04 294 566

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1i7nA01 85.87 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 20 90 2.58 2.85
1ehiA03 85.66 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 15 88 2.07 2.35
1vkzA02 84.75 Thermotoga maritimaPhosphoribosylamine--glycine ligase [EC:6.3.4.13]Purine metabolismPhosphoribosylamine--glycine ligaseMetabolic pathways 3.30.1490.20 70 25 90 2.33 2.59
1gsaA03 83.58 Glutathione metabolismMetabolic pathwaysGlutathione synthase [EC:6.3.2.3]Protein bindingCytosol 3.30.1490.20 65 11 95 3.26 3.42
2nu8B02 81.90 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 25 75 2.20 2.93
3l4jA02 77.44 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.1490.30 47 4 66 3.20 4.80
1x9nA02 75.95 Nucleotide excision repairDNA replicationDNA ligase 1Base excision repairDNA binding 3.30.1490.70 83 4 63 2.73 4.28
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1w96A03
CCTSPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGSPIFIMKLA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1w96A03
CCTSPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGSPIFIMKLA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 03 Mar 2009 21:19

Assigning to "3.30.1490.20" based on similarity with "1w96C03"

Flow stage update by auto on 03 Mar 2009 20:57

No in_process hits for Domain "1w96A03" ready to be processed

Flow stage update by auto on 03 Mar 2009 20:57

NW result present for Domain "1w96A03"

Flow stage update by auto on 03 Mar 2009 20:57

All required files are present for Domain "1w96A03"

Flow stage update by auto on 03 Mar 2009 20:57

Beginning processing for Domain "1w96A03"

Insertion by cuff on 02 Mar 2009 18:48

nice chopping