CATH Domain: 1w85I00 XML data for domain: 1w85I00

Molscript image for 1w85I00
1w85I00
PDB coordinates for domain 1w85I00

PDB 1w85, Chain I, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.320 Dihydrolipoamide Transferase
4.10.320.10 Dihydrolipoamide Transferase Gene3D
4.10.320.10.1
4.10.320.10.1.1
4.10.320.10.1.1.1
4.10.320.10.1.1.1.1
4.10.320.10.1.1.1.1.1

[top]
Segment boundaries for domain 1w85I00

Chopping figure for domain 1w85I00
DomainStart PDB ResidueStop PDB Residue
1w85I00 128 169

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 4.10.320.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1w3dA00 92.97 Geobacillus stearothermophilusDihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex 4.10.320.10 45 100 93 0.92 0.99
1zy8K00 88.26 Homo sapiensPyruvate dehydrogenase protein X component, mitochondrial 4.10.320.10 44 21 90 1.58 1.74
1zwvA00 85.74 Mitochondrial alpha-ketoglutarate dehydrogenase complexLipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrialHomo sapiensMitochondrial nucleoid 4.10.320.10 52 42 80 2.29 2.84
1sxjC02 76.80 Nucleotide excision repairDNA replicationLeading strand elongationReplication factor C subunit 3Replication factor C subunit 3/5 1.10.8.60 69 11 60 2.95 4.85
1in4A03 75.87 Holliday junction DNA helicase RuvBThermotoga maritimaHomologous recombinationHolliday junction ATP-dependent DNA helicase ruvB 1.10.8.60 75 7 53 2.26 4.24
1sxjD02 73.59 DNA replicationNucleotide excision repairLeading strand elongationCell cycle checkpointProtein binding 1.10.8.60 70 9 60 2.79 4.65
1v92A00 73.46 Rattus norvegicusGolgi organizationCellular membrane fusionNSFL1 cofactor p47Protein binding 1.10.8.10 46 7 91 4.56 4.99
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1w85I00
RVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1w85I00
AGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGA
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:58

Assigning to "4.10.320.10" based on similarity with "1w4gA00" (NWSI: 95.7446808510638, NWO: 95.9183673469388, SPS: 93.53, SPO: 93, RMSD: 0.87)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1w85I00"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1w85I00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1w85I00"

Insertion by auto on 09 Mar 2006 17:17

Final ChopClose added based on similarity with "1w4eA" [LEE: 0, LME: 0, MR: 2, LG: 2, SS: 92.77, SI: 95.7446808510638, SO: 95.9183673469388]