CATH Domain: 1w6sB00 XML data for domain: 1w6sB00

Molscript image for 1w6sB00
1w6sB00
PDB coordinates for domain 1w6sB00

PDB 1w6s, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.160 Methanol Dehydrogenase; Chain B
4.10.160.10 Methanol Dehydrogenase, chain B Gene3D
4.10.160.10.1
4.10.160.10.1.1
4.10.160.10.1.1.1
4.10.160.10.1.1.1.1
4.10.160.10.1.1.1.1.1

[top]
Segment boundaries for domain 1w6sB00

Chopping figure for domain 1w6sB00
DomainStart PDB ResidueStop PDB Residue
1w6sB00 1001 1073

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.160.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ad6B00 94.09 Methylophilus methylotrophusMethanol dehydrogenase subunit 2 4.10.160.10 69 68 95 0.82 0.86
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1w6sB00
YDGTKCKAAGNCWEPKPGFPEKIAGSKYDPKHDPKELNKQADSIKQMEERNKKRVENFKKTGKFEYDVAKISA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1w6sB00
YDGTKCKAAGNCWEPKPGFPEKIAGSKYDPKHDPKELNKQADSIKQMEERNKKRVENFKKTGKFEYDVAKISAN
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:47

Assigning to "4.10.160.10" based on similarity with "1h4jB00" (NWSI: 100, NWO: 100, SPS: 94.86, SPO: 100, RMSD: 0.64)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1w6sB00"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1w6sB00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1w6sB00"

Insertion by auto on 09 Mar 2006 13:44

Final ChopClose added based on similarity with "1h4iB" [LEE: 1, LME: 0, MR: 1, LG: 7, SS: 82.34, SI: 100, SO: 100]