CATH Domain: 1w6gA02 XML data for domain: 1w6gA02

Molscript image for 1w6gA02
1w6gA02
PDB coordinates for domain 1w6gA02

PDB 1w6g, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.1
3.10.450.40.1.1
3.10.450.40.1.1.1
3.10.450.40.1.1.1.1
3.10.450.40.1.1.1.1.1

[top]
Segment boundaries for domain 1w6gA02

Chopping figure for domain 1w6gA02
DomainStart PDB ResidueStop PDB Residue
1w6gA01 9 95
1w6gA02 102 203
1w6gA03 204 627

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.10.450.40.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1oacA04 89.77 Tyrosine metabolismGlycine, serine and threonine metabolismPhenylalanine metabolismMetabolic pathwaysBeta-Alanine metabolism 3.10.450.40 106 27 95 1.67 1.75
1ksiA02 88.86 Pisum sativumPrimary amine oxidase 3.10.450.40 96 15 91 1.81 1.99
2oqeA02 87.80 Pichia angustaPeroxisomal primary amine oxidase 3.10.450.40 106 20 87 1.61 1.84
1tu5B02 77.58 Tyrosine metabolismAmine metabolic processBos taurusCopper ion bindingPrimary-amine oxidase [EC:1.4.3.21] 3.10.450.40 122 17 74 3.27 4.38
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1w6gA02
EEEFEVVEQLLATDERWLKALAARNLDVSKVRVAPLSAGVFEYAEERGRRILRGLAFVQDFPEDSAWAHPVDGLVAYVDV
VSKEVTRVIDTGVFPVPAEHGN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1w6gA02
EEEFEVVEQLLATDERWLKALAARNLDVSKVRVAPLSAGVFEYAEERGRRILRGLAFVQDFPEDSAWAHPVDGLVAYVDV
VSKEVTRVIDTGVFPVPAEHGN
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:48

Assigning to "3.10.450.40" based on similarity with "1ui8A02" (NWSI: 100, NWO: 100, SPS: 98.95, SPO: 100, RMSD: 0.18)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1w6gA02"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1w6gA02"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1w6gA02"

Insertion by auto on 09 Mar 2006 13:43

Final ChopClose added based on similarity with "1rjoA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.86, SI: 99.8402555910543, SO: 100]