CATH Domain: 1w6gA01 XML data for domain: 1w6gA01

Molscript image for 1w6gA01
1w6gA01
PDB coordinates for domain 1w6gA01

PDB 1w6g, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.40 Gene3D
3.10.450.40.8
3.10.450.40.8.1
3.10.450.40.8.1.1
3.10.450.40.8.1.1.1
3.10.450.40.8.1.1.1.1

[top]
Segment boundaries for domain 1w6gA01

Chopping figure for domain 1w6gA01
DomainStart PDB ResidueStop PDB Residue
1w6gA01 9 95
1w6gA02 102 203
1w6gA03 204 627

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.10.450.40.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ksiA01 86.92 Pisum sativumPrimary amine oxidase 3.10.450.40 96 14 88 2.43 2.74
1tu5A01 80.48 Tyrosine metabolismAmine metabolic processBos taurusCopper ion bindingPrimary-amine oxidase [EC:1.4.3.21] 3.10.450.40 108 14 76 2.63 3.42
2gu3A02 80.06 Uncharacterized protein ypmBBacillus subtilis 3.10.450.40 63 12 72 2.92 4.03
3hi7B01 80.01 Diamine oxidase [EC:1.4.3.22]Arginine and proline metabolismAmiloride-sensitive amine oxidase [copper-containing]Homo sapiensPrimary amine oxidase activity 3.10.450.40 110 18 79 3.09 3.91
2gu3A01 79.63 Uncharacterized protein ypmBBacillus subtilis 3.10.450.40 65 10 74 2.78 3.72
2ig7A01 78.24 Glycerophospholipid metabolismPhosphatidylethanolamine biosynthetic processEthanolamine kinase activityCholine kinase [EC:2.7.1.32]Choline/ethanolamine kinase 3.10.450.110 80 7 74 3.44 4.60
1t3bA01 72.61 Thiol:disulfide interchange protein DsbC [EC:5.3.4.1]Haemophilus influenzaeThiol:disulfide interchange protein dsbC 3.10.450.70 48 8 55 2.59 4.69
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1w6gA01
ASPFRLASAGEISEVQGILRTAGLLGPEKRIAYLGVLDPARGAGSEAEDRRFRVFIHDVSGARPQEVTVSVTNGTVISAV
ELDTAAT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1w6gA01
PSTIQTASPFRLASAGEISEVQGILRTAGLLGPEKRIAYLGVLDPARGAGSEAEDRRFRVFIHDVSGARPQEVTVSVTNG
TVISAVELDTAAT
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:48

Assigning to "3.10.450.40" based on similarity with "1siiA01" (NWSI: 100, NWO: 100, SPS: 98.51, SPO: 100, RMSD: 0.37)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1w6gA01"

Flow stage update by auto on 28 Apr 2006 17:46

All required files are present for Domain "1w6gA01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1w6gA01"

Insertion by auto on 09 Mar 2006 13:43

Final ChopClose added based on similarity with "1rjoA" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 98.86, SI: 99.8402555910543, SO: 100]