CATH Domain: 1w3dA00 XML data for domain: 1w3dA00

Molscript image for 1w3dA00
1w3dA00
PDB coordinates for domain 1w3dA00

PDB 1w3d, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.320 Dihydrolipoamide Transferase
4.10.320.10 Dihydrolipoamide Transferase Gene3D
4.10.320.10.3
4.10.320.10.3.1
4.10.320.10.3.1.1
4.10.320.10.3.1.1.1
4.10.320.10.3.1.1.1.1

[top]
Segment boundaries for domain 1w3dA00

Chopping figure for domain 1w3dA00
DomainStart PDB ResidueStop PDB Residue
1w3dA00 126 171

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 4.10.320.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1zwvA00 85.47 Mitochondrial alpha-ketoglutarate dehydrogenase complexLipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrialHomo sapiensMitochondrial nucleoid 4.10.320.10 52 42 86 2.76 3.19
2chgA02 79.33 Archaeoglobus fulgidusReplication factor C small subunitReplication factor C small subunit 1.10.8.60 66 11 65 2.38 3.65
1in4A03 78.12 Holliday junction DNA helicase RuvBThermotoga maritimaHomologous recombinationHolliday junction ATP-dependent DNA helicase ruvB 1.10.8.60 75 6 57 2.53 4.41
1njgA02 76.71 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 66 13 62 2.56 4.12
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1w3dA00
NRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1w3dA00
GSAEAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Nov 2006 14:43

Assigning to "4.10.320.10" based on similarity with "1w88I00"

Flow stage update by auto on 17 Oct 2006 09:22

No in_process hits for Domain "1w3dA00" ready to be processed

Flow stage update by auto on 17 Oct 2006 09:22

NW result present for Domain "1w3dA00"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "1w3dA00"

Flow stage update by auto on 16 Oct 2006 03:13

Beginning processing for Domain "1w3dA00"

Insertion by auto on 15 Oct 2006 22:23

Final ChopClose added based on similarity with "1w85I"