Domain assigned by auto on 30 Nov 2006 01:36
Assigning to "3.90.1150.10" based on similarity with "1w23B02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1w23A01 | 16 | 257 |
| 1w23A02 | 258 | 360 |
There are 21 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.11.1.1.1.1 (SIMAX score < 5)
>pdb|1w23A02 GGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASI YNAVPIDACIALRELMIQFKENA
Assigning to "3.90.1150.10" based on similarity with "1w23B02"
No in_process hits for Domain "1w23A02" ready to be processed
NW result present for Domain "1w23A02"
All required files are present for Domain "1w23A02"
Beginning processing for Domain "1w23A02"
Final ChopClose added based on similarity with "1w23B"