Domain assigned by auto on 28 Apr 2006 20:36
Assigning to "3.100.10.10" based on similarity with "1s72O00" (NWSI: 100, NWO: 100, SPS: 98.70, SPO: 100, RMSD: 0.24)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1vq8O00 SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
Assigning to "3.100.10.10" based on similarity with "1s72O00" (NWSI: 100, NWO: 100, SPS: 98.70, SPO: 100, RMSD: 0.24)
NW result present for Domain "1vq8O00"
All required files are present for Domain "1vq8O00"
Beginning processing for Domain "1vq8O00"