Domain assigned by auto on 28 Apr 2006 20:35
Assigning to "3.30.420.100" based on similarity with "1vq6N00" (NWSI: 100, NWO: 100, SPS: 97.41, SPO: 100, RMSD: 0.30)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1vq8N00 ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS GDFDAADLPEHFDELRETLLDGDIEL
Assigning to "3.30.420.100" based on similarity with "1vq6N00" (NWSI: 100, NWO: 100, SPS: 97.41, SPO: 100, RMSD: 0.30)
NW result present for Domain "1vq8N00"
All required files are present for Domain "1vq8N00"
Beginning processing for Domain "1vq8N00"