CATH Domain: 1vq8E01 XML data for domain: 1vq8E01

Molscript image for 1vq8E01
1vq8E01
PDB coordinates for domain 1vq8E01

PDB 1vq8, Chain E, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.930 Outer Surface Protein A; domain 3
3.90.930.12 Gene3D
3.90.930.12.3
3.90.930.12.3.1
3.90.930.12.3.1.1
3.90.930.12.3.1.1.1
3.90.930.12.3.1.1.1.1

[top]
Segment boundaries for domain 1vq8E01

Chopping figure for domain 1vq8E01
DomainStart PDB ResidueStop PDB Residue
1vq8E01 1 79
1vq8E02 80 172

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.90.930.12.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3i1nG01 88.03 RibosomeLarge subunit ribosomal protein L650S ribosomal protein L6Protein bindingEscherichia coli K-12 3.90.930.12 81 24 95 2.58 2.71
1vq8E02 83.14 Large subunit ribosomal protein L6RibosomeHaloarcula marismortui50S ribosomal protein L6P 3.90.930.12 93 12 78 2.87 3.66
1we8A01 80.53 Mus musculusTudor and KH domain-containing proteinMitochondrion 3.30.1370.10 84 10 76 3.23 4.24
1harA02 79.67 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 69 13 86 4.04 4.69
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vq8E01
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vq8E01
MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEG
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 20:36

Assigning to "3.90.930.12" based on similarity with "1vq5E01" (NWSI: 100, NWO: 100, SPS: 98.03, SPO: 100, RMSD: 0.28)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "1vq8E01"

Flow stage update by auto on 28 Apr 2006 17:47

All required files are present for Domain "1vq8E01"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1vq8E01"

Insertion by auto on 09 Mar 2006 23:04

Final ChopClose added based on similarity with "1s72E" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 97.98, SI: 100, SO: 100]