Domain assigned by auto on 11 Jul 2007 08:02
Assigning to "3.40.50.300" based on similarity with "1vmaB02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1vmaA01 | 1 | 83 |
| 1vmaA02 | 84 | 294 |
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1vmaA02 KLNVPPEPPFVIMVVGVNGTGKTTSCGKLAKMFVDEGKSVVLAAADTFRAAAIEQLKIWGERVGATVISHSEGADPAAVA FDAVAHALARNKDVVIIDTAGRLHTKKNLMEELRKVHRVVKKKIPDAPHETLLVIDATTGQNGLVQAKIFKEAVNVTGII LTKLDGTAKGGITLAIARELGIPIKFIGVGEKAEDLRPFDPEAFVEVLLSE
Assigning to "3.40.50.300" based on similarity with "1vmaB02"
No in_process hits for Domain "1vmaA02" ready to be processed
Domain "1vmaA02" hits Domain "1vmaB02" (100% over 100%) which is currently in process
Domain "1vmaA02" hits Domain "1vmaB02" (100% over 100%) which is currently in process
NW result present for Domain "1vmaA02"
All required files are present for Domain "1vmaA02"
Beginning processing for Domain "1vmaA02"
nice chopping