CATH Domain: 1vlgA00 XML data for domain: 1vlgA00

Molscript image for 1vlgA00
1vlgA00
PDB coordinates for domain 1vlgA00

PDB 1vlg, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1260 Ferritin;
1.20.1260.10 Gene3D
1.20.1260.10.12
1.20.1260.10.12.1
1.20.1260.10.12.1.1
1.20.1260.10.12.1.1.1
1.20.1260.10.12.1.1.1.1

[top]
Segment boundaries for domain 1vlgA00

Chopping figure for domain 1vlgA00
DomainStart PDB ResidueStop PDB Residue
1vlgA00 1 164

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 1.20.1260.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3a9qE00 91.98 Ferritin-4, chloroplasticGlycine max 1.20.1260.10 168 25 91 1.19 1.31
1nfvA00 88.88 BacterioferritinBacterioferritinDesulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774 1.20.1260.10 169 17 95 2.54 2.67
2fjcB00 86.04 Treponema pallidumStarvation-inducible DNA-binding proteinAntigen TpF1 1.20.1260.10 156 8 86 3.19 3.68
2qqyA00 85.54 Bacillus anthracisBacterioferritinPutative uncharacterized protein 1.20.1260.10 133 15 81 2.94 3.63
2yw6B00 84.95 Mycobacterium smegmatisDNA protection during starvation proteinStarvation-inducible DNA-binding protein 1.20.1260.10 150 13 86 3.02 3.49
3kwoA00 84.94 DNA protection during starvation proteinCampylobacter jejuniStarvation-inducible DNA-binding proteinProtein binding 1.20.1260.10 144 13 83 3.21 3.84
2ib0A01 84.74 Mycobacterium tuberculosisCONSERVED HYPOTHETICAL ALANINE RICH PROTEIN 1.20.1260.10 135 15 81 2.94 3.60
1jkvA01 83.09 Lactobacillus plantarumManganese catalase 1.20.1260.10 197 13 72 2.74 3.80
2oh3A01 82.70 Magnetospirillum magneticum AMB-1Uncharacterized conserved protein 1.20.1260.10 132 10 75 3.20 4.23
2rklB00 71.89 Multivesicular bodyVacuolar protein sorting-associated protein VTA1Membrane fractionProtein bindingEndocytosis 1.20.5.420 50 12 30 1.05 3.44
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vlgA00
MMVISEKVRKALNDQLNREIYSSYLYLSMATYFDAEGFKGFAHWMKKQAQEELTHAMKFYEYIYERGGRVELEAIEKPPS
NWNGIKDAFEAALKHEEFVTQSIYNILELASEEKDHATVSFLKWFVDEQVEEEDQVREILDLLEKANGQMSVIFQLDRYL
GQRE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vlgA00
MGSDKIHHHHHHMMVISEKVRKALNDQLNREIYSSYLYLSMATYFDAEGFKGFAHWMKKQAQEELTHAMKFYEYIYERGG
RVELEAIEKPPSNWNGIKDAFEAALKHEEFVTQSIYNILELASEEKDHATVSFLKWFVDEQVEEEDQVREILDLLEKANG
QMSVIFQLDRYLGQRE
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:08

Cut based on decision in database "DomChop" on "cathdb"