CATH Domain: 1vlaA02 XML data for domain: 1vlaA02

Molscript image for 1vlaA02
1vlaA02
PDB coordinates for domain 1vlaA02

PDB 1vla, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.300 GMP Synthetase; Chain A, domain 3
3.30.300.20 Gene3D
3.30.300.20.3
3.30.300.20.3.1
3.30.300.20.3.1.1
3.30.300.20.3.1.1.1
3.30.300.20.3.1.1.1.1

[top]
Segment boundaries for domain 1vlaA02

Chopping figure for domain 1vlaA02
DomainStart PDB ResidueStop PDB Residue
1vlaA01 -5 36
1vlaA02 37 138

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.30.300.20.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lqlA02 85.83 Mycoplasma pneumoniaeUncharacterized protein MG427 homolog 3.30.300.20 103 14 92 2.48 2.69
2vqeC01 78.22 RibosomeThermus thermophilus HB8Small subunit ribosomal protein S330S ribosomal protein S3 3.30.300.20 91 5 73 3.11 4.23
1pu1A00 78.13 Methanothermobacter thermautotrophicus str. Delta HUncharacterized protein MTH_677 3.30.300.100 91 12 80 3.66 4.54
2d7vB00 77.65 Vibrio choleraePutative uncharacterized protein 3.30.300.20 151 20 60 2.80 4.65
1egaA02 77.63 GTP-binding protein EraGTP-binding protein eraEscherichia coli K-12 3.30.300.20 106 6 78 3.49 4.46
2pn2A00 77.40 Psychrobacter arcticus 273-4Putative uncharacterized protein 3.30.300.20 129 12 67 2.67 3.96
3h90A02 77.01 Ferrous-iron efflux pump FieFCellular cadmium ion homeostasisCellular zinc ion homeostasisCadmium ion transportEscherichia coli K-12 3.30.70.1350 84 2 79 3.86 4.85
2asbA02 76.91 N utilization substance protein ATranscription elongation protein nusAMycobacterium tuberculosis 3.30.300.20 79 8 72 3.29 4.54
3gkuA02 76.21 Clostridium symbiosum ATCC 14940Probable RNA-binding protein 3.30.300.120 77 10 75 3.67 4.86
1ib8A01 75.71 Hypothetical proteinRibosome maturation factor rimPStreptococcus pneumoniae 3.30.300.70 83 6 77 3.68 4.75
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vlaA02
RPLELVLTGLGCTGDVVSILRKKVIDQKDFRIEIEYERTEEHPRIFTKVHLKYIFKFDGEPPKDKVEKAVQLSQEKYCSV
SAILKCSSKVTYEIVYEN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vlaA02
RPLELVLTGLXGCTGXDVVSILRKXKVIDQXKDFRIEIEYERTEEHPRIFTKVHLKYIFKFDGEPPKDKVEKAVQLSQEK
YCSVSAILKCSSKVTYEIVYEN
BLAST against CATH

[top]
Domain History Events (3)

Insertion by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Flow stage update by sillitoe on 06 Mar 2006 15:40

HomCheck 'Assigned H' domains

Insertion by auto on 06 Mar 2006 00:08

Cut based on decision in database "DomChop" on "cathdb"