CATH Domain: 1vkzA03

1vkzA03

PDB 1vkz, Chain A, Domain 3

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.470	D-amino Acid Aminotransferase; Chain A, domain 1
3.30.470.20	ATP-grasp fold, B domain	Gene3D
3.30.470.20.17
3.30.470.20.17.1
3.30.470.20.17.1.1
3.30.470.20.17.1.1.1
3.30.470.20.17.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 1vkzA03

Domain	Start PDB Residue	Stop PDB Residue
1vkzA01	4	85
1vkzA02	111	180
1vkzA03	181	314
1vkzA04	315	399

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.

[top]
Domain ATOM Sequence

>pdb|1vkzA03
AGNELSAAVVNGRNFVILPFVRDYKRLDGDRGPNTGGGSWGPVEIPSDTIKKIEELFDKTLWGVEKEGYAYRGFLYLGLL
HDGDPYILEYNVRLGDPETEVIVTLNPEGFVNAVLEGYRGGKEPVEPRG

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|1vkzA03
AGNELSAXAVVNGRNFVILPFVRDYKRLXDGDRGPNTGGXGSWGPVEIPSDTIKKIEELFDKTLWGVEKEGYAYRGFLYL
GLXLHDGDPYILEYNVRLGDPETEVIVTLNPEGFVNAVLEGYRGGKXEPVEPRG

BLAST against CATH

[top]
Domain History Events (277)

Domain assigned by cuff on 04 Feb 2008 13:04

nice superfamily match

Domain assignment manual match h by tronnberg on 15 Jan 2008 09:58

SSAP: 89.0 OV: 92 SEQ: 33

Homcheck review by tronnberg on 15 Jan 2008 09:58

SSAP: 89.0 OV: 92 SEQ: 33

Flow stage update by tronnberg on 15 Jan 2008 09:58

SSAP: 89.0 OV: 92 SEQ: 33

Homcheck allotment by tronnberg on 15 Jan 2008 09:45

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 15 Jan 2008 09:45

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 14 Jan 2008 17:53

Calculated SCOP results for 1vkzA03 and inserted them into the database.

Domain scan scop cath by auto on 14 Jan 2008 17:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 52 results for 1vkzA03

Flow stage update by auto on 07 Dec 2007 14:54

Retrieved PRC_PFAMCATH results for job ID SID3506158092924826 and results inserted.

Domain scan prc pfamcath by auto on 07 Dec 2007 14:54

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 36 results for 1vkzA03

Update comment by auto on 06 Dec 2007 06:45

PRC_PFAMCATH job SID3506158092924826 is not yet finished.

Flow stage update by auto on 06 Dec 2007 06:44

The entry "1vkzA03" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 06 Dec 2007 06:44

The entry "1vkzA03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Dec 2007 06:29

Retrieved SSAP results for job ID SID1408983556873472 and results inserted.

Domain scan ssap cath by auto on 06 Dec 2007 06:26

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1857 results for 1vkzA03

Update comment by auto on 05 Dec 2007 15:08

SSAP job SID1408983556873472 is not yet finished.

Ssap cath submit by auto on 05 Dec 2007 15:07

The entry "1vkzA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 15:07

The entry "1vkzA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Dec 2007 15:02

Retrieved PRC results for job ID SID9611359098701232 and inserted them into the database.

Domain scan prc cath by auto on 05 Dec 2007 15:02

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 1vkzA03

Prc cath submit by auto on 05 Dec 2007 14:55

The entry "1vkzA03" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:55

The entry "1vkzA03" has been submitted to the PRC webservice.

Flow stage update by auto on 05 Dec 2007 14:42

Retrieved HMM(SAM) results for job ID SID1883595850106080 and inserted them into the database.

Domain scan sam cath by auto on 05 Dec 2007 14:41

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 1vkzA03

Update comment by auto on 05 Dec 2007 10:58

HMM(SAM) job SID1883595850106080 is not yet finished.

Sam cath submit by auto on 05 Dec 2007 10:52

The entry "1vkzA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:52

The entry "1vkzA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Dec 2007 10:31

Retrieved "1vkzA03" CATHEDRAL results for job ID SID6639759745581344 and inserted them into the database.

Domain scan cathedral cath by auto on 05 Dec 2007 10:31

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 485 results for 1vkzA03

Update comment by auto on 05 Dec 2007 06:33

"1vkzA03" CATHEDRAL job SID6639759745581344 is not yet finished.

Flow stage update by auto on 05 Dec 2007 06:28

The entry "1vkzA03" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 05 Dec 2007 06:27

The entry "1vkzA03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 05 Dec 2007 03:07

Unable to insert the domain scan results from "1vkzA03" CATHEDRAL job SID8863565652272872.

Update comment by auto on 04 Dec 2007 22:57

"1vkzA03" CATHEDRAL job SID8863565652272872 is not yet finished.

Cathedral cath submit by auto on 04 Dec 2007 22:49

The entry "1vkzA03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:49

The entry "1vkzA03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 04 Dec 2007 22:37

ScanList with 11650 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1vkzA03.scanlist" for "1vkzA03"

Write scan list by auto on 04 Dec 2007 22:37

Writing ScanList containing 11650 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1vkzA03.scanlist" for domain "1vkzA03"

Update comment by auto on 04 Dec 2007 18:15

Waiting for 43 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 15:07

Waiting for 127 new domains (example : 2z2eB00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 10:15

Waiting for 206 new domains (example : 2vfzA00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 08:39

Waiting for 257 new domains (example : 2rb8A00) to be processed so that they can be scanned against too.

Update comment by auto on 04 Dec 2007 02:35

Waiting for 335 new domains (example : 2r5qA00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 22:42

Waiting for 410 new domains (example : 2qluA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 18:15

Waiting for 486 new domains (example : 2o2cB01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 14:51

Waiting for 559 new domains (example : 2ihuB03) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 10:15

Waiting for 634 new domains (example : 2e2gJ02) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 07:38

Waiting for 665 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 03 Dec 2007 02:41

Waiting for 642 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 22:32

Waiting for 633 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 18:27

Waiting for 582 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 16:54

Waiting for 555 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 10:15

Waiting for 492 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Dec 2007 07:10

Waiting for 574 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 22:15

Waiting for 624 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 18:53

Waiting for 698 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 14:14

Waiting for 787 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 11:42

Waiting for 869 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 06:27

Waiting for 942 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 01 Dec 2007 02:29

Waiting for 1001 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 23:27

Waiting for 1059 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 18:17

Waiting for 1133 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 14:50

Waiting for 1234 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 10:38

Waiting for 1324 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Nov 2007 08:17

Waiting for 1411 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 22:10

Waiting for 1402 new domains (example : 1vspE00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Nov 2007 11:06

Waiting for 1512 new domains (example : 2e2gA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 29 Nov 2007 10:33

Moving these domains back to write scan list as we want to avoid any problems caused by the remediation that occurred whilst they were progressing through their scans.

Domain scan prc pfamcath by auto on 25 Sep 2007 11:52

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 25 results for 1vkzA03

Flow stage update by auto on 16 Aug 2007 18:45

Retrieved PRC_PFAMCATH results for job ID SID5403524741200560 and chopping inserted.

Update comment by auto on 14 Aug 2007 19:42

PRC_PFAMCATH job SID5403524741200560 is not yet finished.

Prc pfamcath submit by auto on 14 Aug 2007 19:41

The entry "1vkzA03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Aug 2007 19:41

The entry "1vkzA03" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Aug 2007 18:29

Retrieved SSAP results for job ID SID2060365421373520 and chopping inserted.

Domain scan ssap cath by auto on 14 Aug 2007 18:27

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1591 results for 1vkzA03

Update comment by auto on 14 Aug 2007 09:20

SSAP job SID2060365421373520 is not yet finished.

Flow stage update by auto on 14 Aug 2007 07:42

The entry "1vkzA03" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 07:42

The entry "1vkzA03" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Aug 2007 11:07

Retrieved PRC results for job ID SID3323550524015896 and inserted them into the database.

Domain scan prc cath by auto on 13 Aug 2007 11:06

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 1vkzA03

Update comment by auto on 12 Aug 2007 21:56

PRC job SID3323550524015896 is not yet finished.

Prc cath submit by auto on 12 Aug 2007 21:30

The entry "1vkzA03" has been submitted to the PRC webservice.

Flow stage update by auto on 12 Aug 2007 21:30

The entry "1vkzA03" has been submitted to the PRC webservice.

Flow stage update by auto on 12 Aug 2007 18:38

Retrieved HMM(SAM) results for job ID SID6809998711449300 and inserted them into the database.

Domain scan sam cath by auto on 12 Aug 2007 18:37

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 1vkzA03

Update comment by auto on 12 Aug 2007 12:05

HMM(SAM) job SID6809998711449300 is not yet finished.

Flow stage update by auto on 12 Aug 2007 05:48

The entry "1vkzA03" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 12 Aug 2007 05:48

The entry "1vkzA03" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 11 Aug 2007 15:06

Retrieved "1vkzA03" CATHEDRAL results for job ID SID9491509035439344 and inserted them into the database.

Domain scan cathedral cath by auto on 11 Aug 2007 15:04

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 485 results for 1vkzA03

Update comment by auto on 11 Aug 2007 04:40

"1vkzA03" CATHEDRAL job SID9491509035439344 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 02:49

The entry "1vkzA03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:49

The entry "1vkzA03" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 10 Aug 2007 23:30

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1vkzA03.scanlist" for "1vkzA03"

Write scan list by auto on 10 Aug 2007 23:30

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1vkzA03.scanlist" for domain "1vkzA03"

Update comment by auto on 10 Aug 2007 14:25

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:24

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:37

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:38

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:24

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:04

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:47

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:47

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:32

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:38

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:23

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:30

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:29

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 10:52

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:36

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:42

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:32

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:18

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 14:58

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:28

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:39

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:34

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:23

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:38

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:31

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:08

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:02

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 01:57

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 18:50

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:01

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 02:53

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:37

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 18:49

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 14:49

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 10:48

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:43

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 02:49

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:41

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:35

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:27

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:40

Waiting for 3054 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:41

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:41

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:31

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:08

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 14:59

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 10:40

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 06:41

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:41

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:27

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:12

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 14:40

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:31

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:32

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:38

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:23

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:42

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:33

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 10:50

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:04

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:08

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:10

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:33

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:03

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 09:44

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:08

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:02

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:02

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:04

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:05

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 18:43

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 14:38

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 10:39

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 06:45

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 02:48

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:28

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 18:45

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 14:38

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:33

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:31

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:28

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 22:49

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:02

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 15:27

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 10:59

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:07

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:16

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 00:28

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:00

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 10:45

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 06:42

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 02:39

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:32

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 18:51

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 14:48

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 10:43

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 06:46

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 02:43

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 22:48

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 18:53

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 14:45

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 10:55

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:04

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:13

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:12

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:07

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:05

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:05

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:21

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:08

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:00

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:05

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:09

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:07

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:26

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:05

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 19:39

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:29

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:00

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 06:45

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 02:47

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 22:52

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:12

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:14

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:00

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 06:52

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:04

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 22:38

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 18:53

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 14:48

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:00

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 06:58

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:22

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 21:34

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 15:23

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 10:39

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 06:49

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 02:51

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 22:42

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 18:56

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:11

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 10:41

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:26

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:30

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:00

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 22:40

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:20

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:12

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 11:40

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:09

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:14

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:06

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:08

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 17:59

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 12:54

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:04

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 18:53

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 16:09

Waiting for 1013 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 14:07

Waiting for 1040 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 12:22

Waiting for 1062 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 10:01

Waiting for 1110 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 08:02

Waiting for 1159 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 06:01

Waiting for 1205 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 04:01

Waiting for 1240 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 02:05

Waiting for 1265 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 00:04

Waiting for 1270 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 22:04

Waiting for 1282 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 20:08

Waiting for 1285 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 18:06

Waiting for 1276 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 16:07

Waiting for 1258 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 14:04

Waiting for 1144 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 12:05

Waiting for 1163 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 10:03

Waiting for 1196 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 08:03

Waiting for 1231 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 06:04

Waiting for 1257 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 04:02

Waiting for 1280 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 11 Jul 2007 04:01

No satisfactory AssignClose result found.

Flow stage update by auto on 11 Jul 2007 04:00

No in_process hits for Domain "1vkzA03" ready to be processed

Flow stage update by auto on 11 Jul 2007 04:00

NW result present for Domain "1vkzA03"

Flow stage update by auto on 10 Jul 2007 02:18

All required files are present for Domain "1vkzA03"

Flow stage update by auto on 09 Jul 2007 19:10

Beginning processing for Domain "1vkzA03"

Insertion by auto on 09 Jul 2007 18:01

Final ChopClose added based on similarity with "1vkzB"

CATH Domain: 1vkzA03

PDB 1vkz, Chain A, Domain 3

[top] Segment boundaries for domain 1vkzA03

What is a Structural Neighbour?

Structural Neighbourhood (0 entries)

[top] Domain ATOM Sequence

[top] Domain COMBS Sequence

[top] Domain History Events (277)

Domain assigned by cuff on 04 Feb 2008 13:04

Domain assignment manual match h by tronnberg on 15 Jan 2008 09:58

Homcheck review by tronnberg on 15 Jan 2008 09:58

Flow stage update by tronnberg on 15 Jan 2008 09:58

Homcheck allotment by tronnberg on 15 Jan 2008 09:45

Flow stage update by tronnberg on 15 Jan 2008 09:45

Flow stage update by auto on 14 Jan 2008 17:53

Domain scan scop cath by auto on 14 Jan 2008 17:51

Flow stage update by auto on 07 Dec 2007 14:54

Domain scan prc pfamcath by auto on 07 Dec 2007 14:54

Update comment by auto on 06 Dec 2007 06:45

Flow stage update by auto on 06 Dec 2007 06:44

Prc pfamcath submit by auto on 06 Dec 2007 06:44

Flow stage update by auto on 06 Dec 2007 06:29

Domain scan ssap cath by auto on 06 Dec 2007 06:26

Update comment by auto on 05 Dec 2007 15:08

Ssap cath submit by auto on 05 Dec 2007 15:07

Flow stage update by auto on 05 Dec 2007 15:07

Flow stage update by auto on 05 Dec 2007 15:02

Domain scan prc cath by auto on 05 Dec 2007 15:02

Prc cath submit by auto on 05 Dec 2007 14:55

Flow stage update by auto on 05 Dec 2007 14:55

Flow stage update by auto on 05 Dec 2007 14:42

Domain scan sam cath by auto on 05 Dec 2007 14:41

Update comment by auto on 05 Dec 2007 10:58

Sam cath submit by auto on 05 Dec 2007 10:52

Flow stage update by auto on 05 Dec 2007 10:52

Flow stage update by auto on 05 Dec 2007 10:31

Domain scan cathedral cath by auto on 05 Dec 2007 10:31

Update comment by auto on 05 Dec 2007 06:33

Flow stage update by auto on 05 Dec 2007 06:28

Cathedral cath submit by auto on 05 Dec 2007 06:27

Flow stage update by auto on 05 Dec 2007 03:07

Update comment by auto on 04 Dec 2007 22:57

Cathedral cath submit by auto on 04 Dec 2007 22:49

Flow stage update by auto on 04 Dec 2007 22:49

Flow stage update by auto on 04 Dec 2007 22:37

Write scan list by auto on 04 Dec 2007 22:37

Update comment by auto on 04 Dec 2007 18:15

Update comment by auto on 04 Dec 2007 15:07

Update comment by auto on 04 Dec 2007 10:15

Update comment by auto on 04 Dec 2007 08:39

Update comment by auto on 04 Dec 2007 02:35

Update comment by auto on 03 Dec 2007 22:42

Update comment by auto on 03 Dec 2007 18:15

Update comment by auto on 03 Dec 2007 14:51

Update comment by auto on 03 Dec 2007 10:15

Update comment by auto on 03 Dec 2007 07:38

Update comment by auto on 03 Dec 2007 02:41

Update comment by auto on 02 Dec 2007 22:32

Update comment by auto on 02 Dec 2007 18:27

Update comment by auto on 02 Dec 2007 16:54

Update comment by auto on 02 Dec 2007 10:15

Update comment by auto on 02 Dec 2007 07:10

Update comment by auto on 01 Dec 2007 22:15

Update comment by auto on 01 Dec 2007 18:53

Update comment by auto on 01 Dec 2007 14:14

Update comment by auto on 01 Dec 2007 11:42

Update comment by auto on 01 Dec 2007 06:27

Update comment by auto on 01 Dec 2007 02:29

Update comment by auto on 30 Nov 2007 23:27

Update comment by auto on 30 Nov 2007 18:17

Update comment by auto on 30 Nov 2007 14:50

Update comment by auto on 30 Nov 2007 10:38

Update comment by auto on 30 Nov 2007 08:17

Update comment by auto on 29 Nov 2007 22:10

Update comment by auto on 29 Nov 2007 11:06

Flow stage update by auto on 29 Nov 2007 10:33

Domain scan prc pfamcath by auto on 25 Sep 2007 11:52

Flow stage update by auto on 16 Aug 2007 18:45

Update comment by auto on 14 Aug 2007 19:42

Prc pfamcath submit by auto on 14 Aug 2007 19:41

[top]
Segment boundaries for domain 1vkzA03

[top]
Domain ATOM Sequence

[top]
Domain COMBS Sequence

[top]
Domain History Events (277)