CATH Domain: 1vkzA02 XML data for domain: 1vkzA02

Molscript image for 1vkzA02
1vkzA02
PDB coordinates for domain 1vkzA02

PDB 1vkz, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1490 Dna Ligase; domain 1
3.30.1490.20 ATP-grasp fold, A domain Gene3D
3.30.1490.20.11
3.30.1490.20.11.1
3.30.1490.20.11.1.1
3.30.1490.20.11.1.1.1
3.30.1490.20.11.1.1.1.1

[top]
Segment boundaries for domain 1vkzA02

Chopping figure for domain 1vkzA02
DomainStart PDB ResidueStop PDB Residue
1vkzA01 4 85
1vkzA02 111 180
1vkzA03 181 314
1vkzA04 315 399

Structural Neighbourhood (7 entries)

There are 7 matching structural neighberhood comparisons for CATH ID 3.30.1490.20.11.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 7 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ehiA03 84.67 D-Alanine metabolismD-Ala-D-Ala ligase2Peptidoglycan biosynthesisD-alanine-D-alanine ligase [EC:6.3.2.4]Leuconostoc mesenteroides 3.30.1490.20 68 17 88 2.28 2.57
2nu8B02 84.23 Citrate cycle (TCA cycle)Propanoate metabolismMetabolic pathwaysC5-Branched dibasic acid metabolismTricarboxylic acid cycle 3.30.1490.20 84 20 78 2.05 2.61
1i7nA01 82.63 Rattus norvegicusRegulation of neurotransmitter secretionSynapsin-2Cytoskeletal protein binding 3.30.1490.20 60 11 85 2.30 2.68
1m0wB05 78.04 Glutathione synthase [EC:6.3.2.3]Glutathione bindingProtein homodimerization activityGlutathione metabolismMetabolic pathways 3.30.1490.50 60 10 77 3.79 4.91
2r6fA03 76.37 Nucleotide excision repairGeobacillus kaustophilusExcinuclease ABC subunit AExcinuclease ABC subunit A 3.30.1490.20 70 12 81 2.97 3.65
3l4jA02 76.33 Reciprocal meiotic recombinationDNA topoisomerase 2Regulation of mitotic recombinationDNA topoisomerase II [EC:5.99.1.3]DNA strand elongation involved in DNA replication 3.30.1490.30 47 2 60 2.30 3.83
1b33N01 72.91 Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, coreMastigocladus laminosus 3.30.1490.170 55 10 61 3.07 5.00
[1]
Displaying entries 1 to 7 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vkzA02
RFEVAETPEELREKIKKFSPPYVIKADGLARGKGVLILDSKEETIEKGSKLIIGELIKGVKGPVVIDEFL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vkzA02
RFEVAETPEELREKIKKFSPPYVIKADGLARGKGVLILDSKEETIEKGSKLIIGELIKGVKGPVVIDEFL
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 11 Jul 2007 04:01

Assigning to "3.30.1490.20" based on similarity with "1gsoA02"

Flow stage update by auto on 11 Jul 2007 04:00

No in_process hits for Domain "1vkzA02" ready to be processed

Flow stage update by auto on 11 Jul 2007 04:00

NW result present for Domain "1vkzA02"

Flow stage update by auto on 10 Jul 2007 02:18

All required files are present for Domain "1vkzA02"

Flow stage update by auto on 09 Jul 2007 19:10

Beginning processing for Domain "1vkzA02"

Insertion by auto on 09 Jul 2007 18:01

Final ChopClose added based on similarity with "1vkzB"