CATH Domain: 1vkzA01 XML data for domain: 1vkzA01

Molscript image for 1vkzA01
1vkzA01
PDB coordinates for domain 1vkzA01

PDB 1vkz, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.20 Gene3D
3.40.50.20.16
3.40.50.20.16.1
3.40.50.20.16.1.1
3.40.50.20.16.1.1.1
3.40.50.20.16.1.1.1.1

[top]
Segment boundaries for domain 1vkzA01

Chopping figure for domain 1vkzA01
DomainStart PDB ResidueStop PDB Residue
1vkzA01 4 85
1vkzA02 111 180
1vkzA03 181 314
1vkzA04 315 399

Structural Neighbourhood (29 entries)

There are 29 matching structural neighberhood comparisons for CATH ID 3.40.50.20.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 29 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1j6uA01 83.07 D-Glutamine and D-glutamate metabolismThermotoga maritimaUDP-N-acetylmuramate--L-alanine ligaseUDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]Peptidoglycan biosynthesis 3.40.50.720 85 9 83 2.42 2.90
1p3dA01 82.13 D-Glutamine and D-glutamate metabolismUDP-N-acetylmuramate--L-alanine ligaseUDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]Haemophilus influenzaePeptidoglycan biosynthesis 3.40.50.720 87 12 83 2.93 3.49
3eagA01 81.84 UDP-N-acetylmuramate: L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase [EC:6.3.2.-]Neisseria meningitidis serogroup BUDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase 3.40.50.720 88 14 85 2.59 3.04
2x5oA01 80.86 D-Glutamine and D-glutamate metabolismPeptidoglycan biosynthesisMetabolic pathwaysUDP-N-acetylmuramoylalanine--D-glutamate ligaseUDP-N-acetylmuramoylalanine-D-glutamate ligase activity 3.40.50.720 92 12 77 2.38 3.08
1pjqA01 78.86 Porphyrin and chlorophyll metabolismSalmonella enterica subsp. enterica serovar TyphimuriumSiroheme synthaseUroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]Metabolic pathways 3.40.50.720 112 10 66 2.75 4.11
1mioB04 78.38 Nitrogenase molybdenum-iron protein beta chainClostridium pasteurianum 3.40.50.1980 98 7 74 2.64 3.54
2aefA01 77.66 Methanothermobacter thermautotrophicus str. Delta HCalcium-gated potassium channel mthK 3.40.50.720 115 12 65 2.16 3.31
3eq2B01 77.63 Pseudomonas aeruginosaProbable two-component response regulator 3.40.50.2300 103 3 64 3.11 4.85
1m1nB03 77.59 Nitrogenase molybdenum-iron protein beta chain [EC:1.18.6.1]Nitrogen metabolismAzotobacter vinelandiiNitrogenase molybdenum-iron protein beta chainMetabolic pathways 3.40.50.1980 106 7 71 3.11 4.34
1ep3B02 77.38 Lactococcus lactis subsp. cremoris MG1363Dihydroorotate dehydrogenase electron transfer subunitProtein bindingDihydroorotate dehydrogenase electron transfer subunit 3.40.50.80 117 10 65 2.77 4.21
2ho3A01 77.32 Oxidoreductase, Gfo/Idh/MocA familyStreptococcus pneumoniae 3.40.50.720 113 15 67 3.12 4.64
1g7sA03 77.03 Methanothermobacter thermautotrophicus str. Delta HTranslation initiation factor IF-2 unclassified subunitProbable translation initiation factor IF-2 3.40.50.10050 81 6 77 3.37 4.33
1v71A02 77.02 Serine racemaseSchizosaccharomyces pombe 3.40.50.1100 97 16 62 2.63 4.18
1j0aA02 76.62 1-aminocyclopropane-1-carboxylate deaminase [EC:3.5.99.7]Pyrococcus horikoshiiPropanoate metabolismPutative 1-aminocyclopropane-1-carboxylate deaminase 3.40.50.1100 104 11 58 2.40 4.09
2iksA01 76.46 LacI family transcriptional regulator, fructose operon transcriptional repressorFructose repressorEscherichia coli K-12 3.40.50.2300 95 10 69 3.40 4.89
1lssA00 76.40 Trk system potassium uptake protein TrkATrk system potassium uptake protein trkA homologMethanocaldococcus jannaschii 3.40.50.720 132 10 58 2.48 4.25
1a9xA08 75.97 3.40.50.1380 106 12 69 2.98 4.27
1f2dA02 75.51 Williopsis saturnus1-aminocyclopropane-1-carboxylate deaminase 3.40.50.1100 102 9 63 2.85 4.47
2hmtA00 75.10 Trk system potassium uptake protein TrkABacillus subtilisKtr system potassium uptake protein A 3.40.50.720 139 12 55 2.65 4.78
3fpcA02 74.91 Entamoeba histolyticaNADP-dependent alcohol dehydrogenase 3.40.50.720 130 11 58 2.88 4.93
1ve1A02 74.73 Thermus thermophilus HB8Cysteine synthase A [EC:2.5.1.47]Selenoamino acid metabolismCysteine synthaseSulfur metabolism 3.40.50.1100 108 11 55 2.33 4.19
1efdN01 74.51 ABC transportersIron(3+)-hydroxamate-binding protein fhuDIron complex transport system substrate-binding proteinEscherichia coli K-12 3.40.50.1980 91 9 78 3.35 4.29
3d4oA02 74.22 Dipicolinate synthase subunit ABacillus haloduransDipicolinate synthase subunit A 3.40.50.720 139 16 51 2.54 4.97
1mb3A00 74.18 Caulobacter vibrioidesTwo-component systemTwo-component system, cell cycle response regulator DivKPolar differentiation response regulatorCell cycle - Caulobacter 3.40.50.2300 115 12 55 2.70 4.85
1bxrA05 73.82 3.40.50.20 140 11 53 2.53 4.72
2eggA02 73.55 Shikimate 5-dehydrogenase [EC:1.1.1.25]Geobacillus kaustophilusPhenylalanine, tyrosine and tryptophan biosynthesisShikimate 5-dehydrogenaseMetabolic pathways 3.40.50.720 140 10 53 2.56 4.78
3hhpA01 72.81 Citrate cycle (TCA cycle)Pyruvate metabolismGlyoxylate and dicarboxylate metabolismMetabolic pathwaysMalate dehydrogenase [EC:1.1.1.37] 3.40.50.720 138 14 55 2.74 4.98
1t2dA01 72.45 L-lactate dehydrogenaseCysteine and methionine metabolismGlycolysis / GluconeogenesisPyruvate metabolismPlasmodium falciparum CDC/Honduras 3.40.50.720 148 6 49 2.43 4.93
1hyeA01 72.07 Malate dehydrogenase [EC:1.1.1.37]Citrate cycle (TCA cycle)Methanocaldococcus jannaschiiPyruvate metabolismMetabolic pathways 3.40.50.720 147 14 51 2.49 4.88
[1]
Displaying entries 1 to 29 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vkzA01
VRVHILGSGGREHAIGWAFAKQGYEVHFYPGNAGTKRDGTNHPYEGEKTLKAIPEEDIVIPGSEEFLVERSNVFGPV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vkzA01
XGSDKIHHHHHHXKAVRVHILGSGGREHAIGWAFAKQGYEVHFYPGNAGTKRDGTNHPYEGEKTLKAIPEEDIVIPGSEE
FLVEGVSNWRSNVFGPV
BLAST against CATH

[top]
Domain History Events (219)

Domain assigned by cuff on 12 Nov 2007 12:35

similar structure and same function

Homcheck comment by cuff on 29 Oct 2007 11:29

same superfamily

Homcheck comment by tronnberg on 10 Sep 2007 16:15

No matches in the scan list with a SSAP value above 75.5 share the exact same function as the query. Very similar lonkage and structure. But I am not sure if there is sufficient information to put them into the same H- family.

Domain assignment manual match h by tronnberg on 20 Aug 2007 14:56

Great SSAP and Rmsd scores. Very similar in liker fold, a seq similarity of 29. Both are ligases.

Homcheck review by tronnberg on 20 Aug 2007 14:56

Great SSAP and Rmsd scores. Very similar in liker fold, a seq similarity of 29. Both are ligases.

Flow stage update by tronnberg on 20 Aug 2007 14:56

Great SSAP and Rmsd scores. Very similar in liker fold, a seq similarity of 29. Both are ligases.

Homcheck allotment by tronnberg on 20 Aug 2007 14:51

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by tronnberg on 20 Aug 2007 14:51

User 'tronnberg' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 16 Aug 2007 20:08

Calculated SCOP results for 1vkzA01 and inserted them into the database.

Domain scan scop cath by auto on 16 Aug 2007 20:07

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 11 results for 1vkzA01

Flow stage update by auto on 16 Aug 2007 18:44

Retrieved PRC_PFAMCATH results for job ID SID1880984936394272 and chopping inserted.

Domain scan prc pfamcath by auto on 16 Aug 2007 18:43

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 12 results for 1vkzA01

Update comment by auto on 14 Aug 2007 15:45

PRC_PFAMCATH job SID1880984936394272 is not yet finished.

Prc pfamcath submit by auto on 14 Aug 2007 15:45

The entry "1vkzA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Aug 2007 15:45

The entry "1vkzA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 14 Aug 2007 14:35

Retrieved SSAP results for job ID SID0476743478385280 and chopping inserted.

Domain scan ssap cath by auto on 14 Aug 2007 14:31

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2425 results for 1vkzA01

Update comment by auto on 14 Aug 2007 09:21

SSAP job SID0476743478385280 is not yet finished.

Flow stage update by auto on 14 Aug 2007 07:42

The entry "1vkzA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 14 Aug 2007 07:42

The entry "1vkzA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 13 Aug 2007 11:08

Retrieved PRC results for job ID SID6037780837281632 and inserted them into the database.

Domain scan prc cath by auto on 13 Aug 2007 11:07

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 1vkzA01

Update comment by auto on 12 Aug 2007 21:56

PRC job SID6037780837281632 is not yet finished.

Prc cath submit by auto on 12 Aug 2007 21:30

The entry "1vkzA01" has been submitted to the PRC webservice.

Flow stage update by auto on 12 Aug 2007 21:30

The entry "1vkzA01" has been submitted to the PRC webservice.

Flow stage update by auto on 12 Aug 2007 18:38

Retrieved HMM(SAM) results for job ID SID7495410274202848 and inserted them into the database.

Domain scan sam cath by auto on 12 Aug 2007 18:38

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 1vkzA01

Update comment by auto on 12 Aug 2007 12:05

HMM(SAM) job SID7495410274202848 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 05:48

The entry "1vkzA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 05:48

The entry "1vkzA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 11 Aug 2007 15:08

Retrieved "1vkzA01" CATHEDRAL results for job ID SID5425706401214836 and inserted them into the database.

Domain scan cathedral cath by auto on 11 Aug 2007 15:06

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 495 results for 1vkzA01

Update comment by auto on 11 Aug 2007 04:40

"1vkzA01" CATHEDRAL job SID5425706401214836 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 02:49

The entry "1vkzA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 02:49

The entry "1vkzA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 10 Aug 2007 23:30

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1vkzA01.scanlist" for "1vkzA01"

Write scan list by auto on 10 Aug 2007 23:30

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1vkzA01.scanlist" for domain "1vkzA01"

Update comment by auto on 10 Aug 2007 14:25

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:24

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:37

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:38

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:24

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:04

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:47

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:47

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:33

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:38

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:23

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:30

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:29

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 10:52

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:36

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:42

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:32

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:18

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 14:58

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:28

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:39

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:34

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:23

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:38

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:31

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:08

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:02

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 01:57

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 18:50

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:01

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 02:53

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:37

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 18:49

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 14:49

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 10:48

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:43

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 02:49

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:41

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:35

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:27

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:40

Waiting for 3054 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:41

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:41

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:31

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:08

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 14:59

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 10:40

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 06:41

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:41

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:27

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:12

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 14:40

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:31

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:32

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:38

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:23

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:42

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:33

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 10:50

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:04

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:08

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:10

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:34

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:03

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 09:44

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:08

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:02

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:02

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:04

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:05

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 18:43

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 14:39

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 10:39

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 06:45

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 02:48

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:28

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 18:45

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 14:39

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:33

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:31

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:28

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 22:49

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:02

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 15:27

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 10:59

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:07

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:16

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 00:28

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:00

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 10:45

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 06:42

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 02:39

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:32

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 18:52

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 14:48

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 10:43

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 06:46

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 02:43

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 22:48

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 18:53

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 14:45

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 10:55

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:04

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:13

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:13

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:07

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:05

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:05

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:21

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:08

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:00

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:05

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:09

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:07

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:27

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:05

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 19:39

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:29

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:00

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 06:45

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 02:47

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 22:52

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:13

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:14

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:00

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 06:52

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:04

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 22:38

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 18:53

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 14:48

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:00

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 06:57

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:22

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 21:33

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 15:23

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 10:39

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 06:48

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 02:51

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 22:42

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 18:55

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:11

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 10:41

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:26

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:30

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:00

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 22:39

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:19

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:12

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 11:40

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:09

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:14

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:06

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:08

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 17:59

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 12:54

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:04

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 18:53

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 16:09

Waiting for 1013 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 14:07

Waiting for 1040 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 12:22

Waiting for 1062 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 10:01

Waiting for 1110 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 08:02

Waiting for 1159 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 06:01

Waiting for 1205 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 04:01

Waiting for 1240 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 02:05

Waiting for 1265 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 00:04

Waiting for 1270 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 22:04

Waiting for 1282 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 20:08

Waiting for 1285 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 18:06

Waiting for 1276 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 16:07

Waiting for 1258 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 14:04

Waiting for 1144 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 12:05

Waiting for 1163 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 10:03

Waiting for 1196 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 08:03

Waiting for 1231 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 06:04

Waiting for 1257 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 04:02

Waiting for 1280 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Flow stage update by auto on 11 Jul 2007 04:01

No satisfactory AssignClose result found.

Flow stage update by auto on 11 Jul 2007 04:00

No in_process hits for Domain "1vkzA01" ready to be processed

Flow stage update by auto on 11 Jul 2007 04:00

NW result present for Domain "1vkzA01"

Flow stage update by auto on 10 Jul 2007 02:18

All required files are present for Domain "1vkzA01"

Flow stage update by auto on 09 Jul 2007 19:10

Beginning processing for Domain "1vkzA01"

Insertion by auto on 09 Jul 2007 18:01

Final ChopClose added based on similarity with "1vkzB"