CATH Domain: 1vkeE00 XML data for domain: 1vkeE00

Molscript image for 1vkeE00
1vkeE00
PDB coordinates for domain 1vkeE00

PDB 1vke, Chain E, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1290 AhpD-like
1.20.1290.10 AhpD-like Gene3D
1.20.1290.10.4
1.20.1290.10.4.1
1.20.1290.10.4.1.1
1.20.1290.10.4.1.1.1
1.20.1290.10.4.1.1.1.1

[top]
Segment boundaries for domain 1vkeE00

Chopping figure for domain 1vkeE00
DomainStart PDB ResidueStop PDB Residue
1vkeE00 2 121

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1290.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vkeB00 95.87 Thermotoga maritimaPutative uncharacterized protein 1.20.1290.10 101 100 84 0.24 0.28
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vkeE00
EYKKFVEARRELNEKVSRGTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCDDCIRYHLVRCVQEGASDEEIFE
ALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGETISL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vkeE00
MGSDKIHHHHHHMEYKKFVEARRELNEKVLSRGTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCDDCIRYHLV
RCVQEGASDEEIFEALDIALVVGGSIVIPHLRRAVGFLEELREMEKNGETISL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:18

Assigning to "1.20.1290.10" based on similarity with "1vkeA00" (NWSI: 100, NWO: 100, SPS: 98.22, SPO: 98, RMSD: 0.32)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1vkeE00"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1vkeE00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1vkeE00"

Insertion by auto on 09 Mar 2006 07:22

Final ChopClose added based on similarity with "1vkeA" [LEE: 2, LME: 0, MR: 0, LG: 2, SS: 98.22, SI: 100, SO: 100]