CATH Domain: 1vkeB00 XML data for domain: 1vkeB00

Molscript image for 1vkeB00
1vkeB00
PDB coordinates for domain 1vkeB00

PDB 1vke, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1290 AhpD-like
1.20.1290.10 AhpD-like Gene3D
1.20.1290.10.6
1.20.1290.10.6.1
1.20.1290.10.6.1.1
1.20.1290.10.6.1.1.1
1.20.1290.10.6.1.1.1.1

[top]
Segment boundaries for domain 1vkeB00

Chopping figure for domain 1vkeB00
DomainStart PDB ResidueStop PDB Residue
1vkeB00 21 121

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.1290.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3bulA01 81.59 One carbon pool by folateMetabolic pathwaysCysteine and methionine metabolismEscherichia coli K-12Methionine synthase activity 1.10.1240.10 87 16 71 2.93 4.11
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vkeB00
GTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCDDCIRYHLVRCVQEGASDEEIFEALDIALVVGGSIVIPHLR
RAVGFLEELREMEKNGETISL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vkeB00
GTLNTKRFFNLDSAVYRPGKLDVKTKELMGLVASTVLRCDDCIRYHLVRCVQEGASDEEIFEALDIALVVGGSIVIPHLR
RAVGFLEELREMEKNGETISL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 19:19

Assigning to "1.20.1290.10" based on similarity with "1vkeF00" (NWSI: 100, NWO: 99.0196078431373, SPS: 97.74, SPO: 95, RMSD: 0.25)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1vkeB00"

Flow stage update by auto on 28 Apr 2006 17:45

All required files are present for Domain "1vkeB00"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1vkeB00"

Insertion by auto on 06 Mar 2006 00:08

Cut based on decision in database "DomChop" on "cathdb"