Domain assigned by auto on 15 Feb 2008 17:24
Assigning to "2.60.40.1180" based on similarity with "1bplB02"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1vjsA01 | 3 | 103 |
| 1vjsA01 | 206 | 396 |
| 1vjsA02 | 104 | 205 |
| 1vjsA03 | 397 | 482 |
There are 20 matching structural neighberhood comparisons for CATH ID 2.60.40.1180.9.1.1.1.2 (SIMAX score < 5)
>pdb|1vjsA03 GAQHDYFDHHDIVGWTREGDSSVANSGLAALITDGPGGAKRMYVGRQNAGETWHDITGNRSEPVVINSEGWGEFHVNGGS VSIYVQ
Assigning to "2.60.40.1180" based on similarity with "1bplB02"
No in_process hits for Domain "1vjsA03" ready to be processed
Domain "1vjsA03" hits Domain "1bplB02" (100% over 100%) which is currently in process
Domain "1vjsA03" hits Domain "1bplB02" (100% over 100%) which is currently in process
NW result present for Domain "1vjsA03"
All required files are present for Domain "1vjsA03"
Beginning processing for Domain "1vjsA03"
Around September/October 2007, this domain was renamed from "1vjs003" to "1vjsA03" as part of the work to deal with the remediation of the PDB (see http://remediation.wwpdb.org). Please see ticket:207 or wiki:Remediation on the CATH Trac system for more details.
nice chopping