Flow stage update by cuff on 25 Apr 2006 18:50
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
There are 6 matching structural neighberhood comparisons for CATH ID 3.40.50.10490.3.1.1.1.1 (SIMAX score < 5)
>pdb|1vimA00 HGGHMSLLRFLEVVSEHIKNLRNHIDLETVGEMIKLIDSARSIFVIGAGRSGYIAKAFAMRLMHLGYTVYVVGETVTPRI TDQDVLVGISGSGETTSVVNISKKAKDIGSKLVAVTGKRDSSLAKMADVVMVVKGKMKQERDEILSQLAPLGTMFELTAM IFLDALVAEIMMQKHLTEKDLEARHAVLEEGG
COMMENT: Sarah - Scores are quite good FINAL: Lesley - Yes, merge. Very good scores. Chopping looks fine. Move 1940 into 10940.
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"