Domain assigned by auto on 28 Apr 2006 18:43
Assigning to "3.40.192.10" based on similarity with "1vi2B01" (NWSI: 95.3020134228188, NWO: 100, SPS: 97.98, SPO: 98, RMSD: 0.33)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1vi2A01 | 5 | 107 |
| 1vi2A01 | 259 | 288 |
| 1vi2A02 | 108 | 257 |
There are 1 matching structural neighberhood comparisons for CATH ID 3.40.192.10.8.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1npyA01 | 86.33 | 3.40.192.10 | 100 | 34 | 72 | 1.18 | 1.63 |
>pdb|1vi2A01 AKYELIGLAYPIRHSLSPEQNKALEKAGLPFTYAFEVDNDSFPGAIEGLKALKRGTGVSPNKQLACEYVDELTPAAKLVG AINTIVNDDGYLRGYNTDLLWQGAEQFTLWTGKDFPLEYVKQVGFGA
Assigning to "3.40.192.10" based on similarity with "1vi2B01" (NWSI: 95.3020134228188, NWO: 100, SPS: 97.98, SPO: 98, RMSD: 0.33)
NW result present for Domain "1vi2A01"
All required files are present for Domain "1vi2A01"
Beginning processing for Domain "1vi2A01"