CATH Domain: 1vhyA02 XML data for domain: 1vhyA02

Molscript image for 1vhyA02
1vhyA02
PDB coordinates for domain 1vhyA02

PDB 1vhy, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1280 Alpha/beta knot
3.40.1280.10 Gene3D
3.40.1280.10.6
3.40.1280.10.6.1
3.40.1280.10.6.1.1
3.40.1280.10.6.1.1.1
3.40.1280.10.6.1.1.1.1

[top]
Segment boundaries for domain 1vhyA02

Chopping figure for domain 1vhyA02
DomainStart PDB ResidueStop PDB Residue
1vhyA01 3 73
1vhyA02 74 247

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.40.1280.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1v6zA02 88.46 Thermus thermophilus HB27Ribosomal RNA small subunit methyltransferase E [EC:2.1.1.-]Hypothetical conserved protein 3.40.1280.10 161 27 92 1.93 2.08
1vhkA02 86.98 Bacillus subtilisRibosomal RNA small subunit methyltransferase ERibosomal RNA small subunit methyltransferase E [EC:2.1.1.-] 3.40.1280.10 160 30 91 1.93 2.11
1vhkB00 83.55 Bacillus subtilisRibosomal RNA small subunit methyltransferase ERibosomal RNA small subunit methyltransferase E [EC:2.1.1.-] 3.40.1280.10 194 28 79 1.99 2.51
1k3rA01 78.19 Hypothetical proteinMethanothermobacter thermautotrophicus str. Delta HConserved protein 3.40.1280.10 191 10 76 3.32 4.31
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vhyA02
KESHLKIHLGQVIREFTIQKSVELGVNVITPLWSERCGVKLDAERDKKIQQWQKIAIAACEQCGRNIVPEIRPLKLQDWC
AENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAISALQICF
GDLGEEG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vhyA02
KESHLKIHLGQVISRGERXEFTIQKSVELGVNVITPLWSERCGVKLDAERXDKKIQQWQKIAIAACEQCGRNIVPEIRPL
XKLQDWCAENDGALKLNLHPRAHYSIKTLPTIPAGGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRVLRTETASLAAI
SALQICFGDLGEEGGSHHHHHH
BLAST against CATH

[top]
Domain History Events (3)

Set cath from cathlist by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Flow stage update by auto on 05 Mar 2006 19:29

This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"

Insertion by auto on 05 Mar 2006 17:50

PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"