Domain assigned by auto on 28 Apr 2006 18:44
Assigning to "3.30.420.140" based on similarity with "1vhxA00" (NWSI: 95.3333333333333, NWO: 100, SPS: 94.87, SPO: 98, RMSD: 1.01)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1vhxB00 SLRILGLDLGTKTLGVALSDEGWTAQGIETIKINEAEGDYGLSRLSELIKDYTIDKIVLGFPKNNGTVGPRGEASQTFAK VLETTYNVPVVLWDERLTTAAEKLIAADVSRQKRKKVIDKAAVILQGYLDSL
Assigning to "3.30.420.140" based on similarity with "1vhxA00" (NWSI: 95.3333333333333, NWO: 100, SPS: 94.87, SPO: 98, RMSD: 1.01)
NW result present for Domain "1vhxB00"
All required files are present for Domain "1vhxB00"
Beginning processing for Domain "1vhxB00"