CATH Domain: 1vhsA00

There are 47 matching structural neighberhood comparisons for CATH ID 3.40.630.30.14.1.1.2.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	2ge3B00	87.24	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	20	93	2.17	2.32
	2i79D00	86.68	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	24	91	2.52	2.77
	2ae6A00	86.68	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	22	90	2.68	2.95
	3k9uA00	86.01	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	16	86	2.04	2.37
	2r7hB00	85.87	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	3.40.630.30	157	18	93	2.78	2.97
	3g8wA00	85.69	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	15	93	2.52	2.69
	2fiwA00	85.52	Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris	3.40.630.30	156	13	86	2.83	3.27
	3eo4A00	85.50	Methanocaldococcus jannaschiiUncharacterized protein MJ1062	3.40.630.30	155	20	87	2.28	2.60
	1tiqB00	85.41	Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1	3.40.630.30	161	17	88	2.46	2.79
	3exnA00	85.29	Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation	3.40.630.30	151	20	89	2.54	2.83
	2q7bA00	85.28	Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V	3.40.630.30	161	15	85	3.09	3.60
	2fiaA00	84.62	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	16	91	2.82	3.10
	3fbuA00	83.42	Bacillus anthracisAcetyltransferase, GNAT family	3.40.630.30	166	20	86	2.64	3.04
	1q2yA00	83.29	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	11	85	3.21	3.74
	1s3zA00	83.20	Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase	3.40.630.30	147	13	89	4.29	4.82
	1qsmD00	82.98	CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2	3.40.630.30	152	18	88	3.16	3.58
	1n71B00	82.92	Aac(6')-Ii proteinEnterococcus faecium	3.40.630.30	179	11	81	2.68	3.31
	1cjwA00	82.54	Ovis ariesSerotonin N-acetyltransferase	3.40.630.30	166	14	86	2.93	3.38
	1nslA00	82.43	Bacillus subtilisPutative ribosomal N-acetyltransferase ydaF	3.40.630.30	173	19	86	3.28	3.78
	2i00C01	81.85	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	10	81	2.86	3.52
	3d3sA00	81.79	L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways	3.40.630.30	157	16	92	3.00	3.25
	3fb3A00	81.77	Amino sugar and nucleotide sugar metabolismGlucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]N-acetyltransferase, putativeTrypanosoma brucei	3.40.630.30	141	17	87	3.58	4.11
	1xebA00	81.71	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	15	85	2.84	3.31
	2dxqA00	81.61	Agrobacterium tumefaciens str. C58Acetyltransferase	3.40.630.30	145	18	83	2.84	3.39
	1yreC00	81.61	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	182	14	82	3.13	3.77
	2pdoA01	81.55	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	18	73	2.87	3.90
	2qecA00	81.30	Corynebacterium glutamicumGCN5-related N-acetyltransferase	3.40.630.30	175	14	81	3.52	4.34
	1sqhA02	81.13	Drosophila melanogasterCG14615	3.40.630.30	128	14	72	2.70	3.74
	1y9kA01	80.95	Tyrosine metabolismLimonene and pinene degradationIAA acetyltransferaseBacillus cereus ATCC 145791- and 2-Methylnaphthalene degradation	3.40.630.30	110	20	70	3.11	4.42
	2ozgA01	80.91	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	117	16	74	2.62	3.50
	3efaA00	80.78	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	12	85	3.47	4.04
	3f5bA00	80.66	Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1	3.40.630.30	163	11	89	4.41	4.92
	2r1iA01	80.24	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	13	78	3.22	4.12
	2fckA00	80.03	Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative	3.40.630.30	171	13	84	4.19	4.98
	1lrzA01	79.82	Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus	3.40.630.30	143	9	81	3.79	4.63
	2fl4A02	79.81	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	10	65	2.74	4.20
	2qmlA00	79.67	BH2621 proteinBacillus halodurans	3.40.630.30	184	12	76	3.58	4.67
	1y9wA01	79.53	AcetyltransferaseBacillus cereus ATCC 14579	3.40.630.30	104	23	65	2.40	3.65
	2atrA00	79.18	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	127	18	77	3.59	4.64
	1y7rA00	78.71	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	125	16	74	3.34	4.46
	1bo4A00	78.63	Aminoglycoside-(3)-N-acetyltransferaseSerratia marcescens	3.40.630.30	136	8	80	3.45	4.28
	2g3aA02	77.80	Agrobacterium tumefaciens str. C58Acetyltransferase	3.40.630.30	97	20	61	2.67	4.31
	2hv2A03	77.24	Enterococcus faecalisPutative uncharacterized protein	3.40.630.30	148	6	78	3.50	4.45
	3dnsA00	76.91	Ribosomal-protein-alanine N-acetyltransferase [EC:2.3.1.128]Clostridium acetobutylicumRibosomal-protein-alanine acetyltransferase (Acetylating enzyme for N-terminal of ribosomal protein S5)	3.40.630.30	126	8	73	3.53	4.80
	1ro5A01	75.25	Pseudomonas aeruginosaAcyl homoserine lactone synthase [EC:2.3.1.184]Acyl-homoserine-lactone synthase	3.40.630.30	187	12	75	3.63	4.81
	1lrzA02	74.49	Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus	3.40.630.30	195	7	62	3.00	4.83
	2ozgA02	74.01	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	163	7	78	3.81	4.85

>pdb|1vhsA00
SLTLRLAEHRDLEAVVAIYNSTIASRVTADTEPVTPEDREWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYNKTA
EVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEDGKRYDLKILGRELS
E    

>pdb|1vhsA00
XSLTLRLAEHRDLEAVVAIYNSTIASRXVTADTEPVTPEDRXEWFSGHTESRPLYVAEDENGNVAAWISFETFYGRPAYN
KTAEVSIYIDEACRGKGVGSYLLQEALRIAPNLGIRSLXAFIFGHNKPSLKLFEKHGFAEWGLFPGIAEXDGKRYDLKIL
GRELSEGGSHHHHHH