CATH Domain: 1vhoA01 XML data for domain: 1vhoA01

Molscript image for 1vhoA01
1vhoA01
PDB coordinates for domain 1vhoA01

PDB 1vho, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.18
3.40.630.10.18.1
3.40.630.10.18.1.1
3.40.630.10.18.1.1.1
3.40.630.10.18.1.1.1.1

[top]
Segment boundaries for domain 1vhoA01

Chopping figure for domain 1vhoA01
DomainStart PDB ResidueStop PDB Residue
1vhoA01 4 69
1vhoA01 155 333
1vhoA02 70 154

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.40.630.10.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2cf4A01 85.55 Pyrococcus horikoshiiPutative uncharacterized protein PH0519 3.40.630.10 236 29 95 2.62 2.75
1yloA01 85.32 Shigella flexneriPutative uncharacterized protein 3.40.630.10 254 27 90 2.93 3.25
2greA01 85.06 Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579 3.40.630.10 233 18 92 2.42 2.61
3cpxB01 84.72 Aminopeptidase, M42 familyCytophaga hutchinsonii ATCC 33406 3.40.630.10 243 22 89 2.66 2.97
3ct9B01 80.97 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.40.630.10 233 17 85 2.79 3.26
1cg2A01 80.33 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 16 79 2.66 3.36
2qyvA01 79.86 Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C 3.40.630.10 250 15 86 3.38 3.91
2glfA01 78.30 Thermotoga maritimaProbable M18 family aminopeptidase 1 3.40.630.10 304 16 73 2.70 3.66
2ijzA01 78.01 Aminopeptidase [EC:3.4.11.-]Pseudomonas aeruginosaProbable M18 family aminopeptidase 2 3.40.630.10 272 10 82 3.09 3.75
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1vhoA01
ETGKLLELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAFFAHVDEIQTAFETNGKVVGKAL
DNRASCGVLVKVLEFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVDVTFASEPPFSDHIELGKGPVIGLGP
VVDRNLVQKIIEIAKKHNVSLQEEAVGGRTDFVQLVRNGVRTSLISIPLKYHTPVEVDPRDVEELARLLSLVAVELE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vhoA01
XSLKXETGKLLXELSNLDGPSGYETNVVSYIKSVIEPFVDEAKTTRHGSLIGYKKGKGIGKLAFFAHVDEIQTAFETNGK
VVGKALDNRASCGVLVKVLEFLKRYDHPWDVYVVFSVQEETGCLGALTGAYEINPDAAIVXDVTFASEPPFSDHIELGKG
PVIGLGPVVDRNLVQKIIEIAKKHNVSLQEEAVGGRSGTETDFVQLVRNGVRTSLISIPLKYXHTPVEXVDPRDVEELAR
LLSLVAVELEVEGGSHHHHHH
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 18:43

Assigning to "3.40.630.10" based on similarity with "1vheA01" (NWSI: 37.5478927203065, NWO: 91.8727915194346, SPS: 86.84, SPO: 86, RMSD: 2.73)

Flow stage update by auto on 28 Apr 2006 17:50

NW result present for Domain "1vhoA01"

Flow stage update by auto on 28 Apr 2006 17:44

All required files are present for Domain "1vhoA01"

Flow stage update by auto on 27 Apr 2006 17:31

Beginning processing for Domain "1vhoA01"

Insertion by auto on 06 Mar 2006 00:07

Cut based on decision in database "DomChop" on "cathdb"