CATH Domain: 1vheA01

There are 16 matching structural neighberhood comparisons for CATH ID 3.40.630.10.11.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1yloA01	89.83	Shigella flexneriPutative uncharacterized protein	3.40.630.10	254	34	94	2.02	2.15
	1vhoA01	86.84	Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase	3.40.630.10	237	34	86	2.73	3.17
	2cf4A01	86.47	Pyrococcus horikoshiiPutative uncharacterized protein PH0519	3.40.630.10	236	33	86	1.78	2.07
	3cpxB01	85.73	Aminopeptidase, M42 familyCytophaga hutchinsonii ATCC 33406	3.40.630.10	243	20	83	2.45	2.92
	2greA01	83.78	Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579	3.40.630.10	233	18	84	2.66	3.14
	1cg2A01	82.66	Pseudomonas sp. RS-16Carboxypeptidase G2	3.40.630.10	279	16	84	2.91	3.44
	2qyvA01	81.38	Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C	3.40.630.10	250	17	84	2.98	3.52
	1xmbA01	81.37	Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2	3.40.630.10	274	10	85	2.90	3.41
	3ct9B01	81.11	Bacteroides thetaiotaomicronAcetylornithine deacetylase	3.40.630.10	233	15	80	3.23	4.03
	1z2lB01	80.80	Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding	3.40.630.10	295	15	77	2.88	3.73
	1vgyA01	80.47	Succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Neisseria meningitidis serogroup BLysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase	3.40.630.10	256	13	86	3.21	3.71
	2glfA01	80.33	Thermotoga maritimaProbable M18 family aminopeptidase 1	3.40.630.10	304	14	76	2.74	3.59
	2ijzA01	79.89	Aminopeptidase [EC:3.4.11.-]Pseudomonas aeruginosaProbable M18 family aminopeptidase 2	3.40.630.10	272	9	87	2.84	3.26
	2v8hA01	78.78	Beta-alanine synthaseLachancea kluyveri	3.40.630.10	315	17	75	3.30	4.39
	3kasA01	78.30	Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis	3.40.630.10	308	12	74	3.61	4.86
	2rb7A01	77.54	Peptidase, M20/M25/M40 familyDesulfovibrio desulfuricans subsp. desulfuricans str. G20	3.40.630.10	231	14	76	3.45	4.49

>pdb|1vheA01
KLDETLTLKDLTDAKGIPGNEREVRQVKSYIEPFADEVTTDRLGSLIAKKTGAENGPKIIAGHLDEVGFFEFTVNNEKFL
LAKAWDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGIAGDTPGISEKEAQSKG
KGPQIIVYDASVSHKGLRDAVVATAEEAGIPYQFDAIAGGGTDSGAIHLTANGVPALSITIATRYIHTHAALHRDDYENA
VKLITEVIKKLDRKTVDEITYQEGGSHH    

>pdb|1vheA01
XSLAKLDETLTXLKDLTDAKGIPGNEREVRQVXKSYIEPFADEVTTDRLGSLIAKKTGAENGPKIXIAGHLDEVGFFEFT
VXNNEKFLLAKAWDNRIGCAIAIDVLRNLQNTDHPNIVYGVGTVQEEVGLRGAKTAAHTIQPDIAFGVDVGIAGDTPGIS
EKEAQSKXGKGPQIIVYDASXVSHKGLRDAVVATAEEAGIPYQFDAIAGGGTDSGAIHLTANGVPALSITIATRYIHTHA
AXLHRDDYENAVKLITEVIKKLDRKTVDEITYQEGGSHHHHHH