CATH Domain: 1vgyA01

There are 12 matching structural neighberhood comparisons for CATH ID 3.40.630.10.15.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	3ct9B01	85.47	Bacteroides thetaiotaomicronAcetylornithine deacetylase	3.40.630.10	233	21	87	2.27	2.61
	1cg2A01	83.41	Pseudomonas sp. RS-16Carboxypeptidase G2	3.40.630.10	279	21	88	2.53	2.87
	2qyvA01	83.01	Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C	3.40.630.10	250	16	90	3.02	3.35
	2greA01	80.79	Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579	3.40.630.10	233	14	86	3.22	3.71
	3cpxB01	80.60	Aminopeptidase, M42 familyCytophaga hutchinsonii ATCC 33406	3.40.630.10	243	14	87	3.81	4.35
	1yloA01	80.09	Shigella flexneriPutative uncharacterized protein	3.40.630.10	254	14	86	2.91	3.36
	2cf4A01	79.71	Pyrococcus horikoshiiPutative uncharacterized protein PH0519	3.40.630.10	236	16	87	2.98	3.42
	1vhoA01	79.46	Endoglucanase [EC:3.2.1.4]Thermotoga maritimaStarch and sucrose metabolismEndoglucanase	3.40.630.10	237	12	85	3.38	3.95
	1z2lB01	78.74	Purine metabolismZinc ion bindingProtein homodimerization activityAllantoate deiminase [EC:3.5.3.9]Manganese ion binding	3.40.630.10	295	11	78	3.27	4.18
	2glfA01	77.92	Thermotoga maritimaProbable M18 family aminopeptidase 1	3.40.630.10	304	13	72	3.04	4.20
	2ijzA01	77.59	Aminopeptidase [EC:3.4.11.-]Pseudomonas aeruginosaProbable M18 family aminopeptidase 2	3.40.630.10	272	8	83	3.24	3.88
	3kasA01	76.79	Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis	3.40.630.10	308	7	73	2.98	4.08

>pdb|1vgyA01
TETQSLELAKELISRPSVTPDDRDCQKLAERLHKIGFAAEEHFGNTKNIWLRRGTKAPVVCFAGHTDVVPTGPVEKWDSP
PFEPAERDGRLYGRGAADKTSIACFVTACERFVAKHPNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGE
PTAVDKLGDIKNGRPFLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAAQELIELGPSNATIHQINENVRLND
IPKLSAVYEGILVRLL    

>pdb|1vgyA01
XSLTETQSLELAKELISRPSVTPDDRDCQKLXAERLHKIGFAAEEXHFGNTKNIWLRRGTKAPVVCFAGHTDVVPTGPVE
KWDSPPFEPAERDGRLYGRGAADXKTSIACFVTACERFVAKHPNHQGSIALLITSDEEGDALDGTTKVVDVLKARDELID
YCIVGEPTAVDKLGDXIKNGRPFLTQAGKLTDVARAAIAETCGIEAELSTTGGTSDGRFIKAXAQELIELGPSNATIHQI
NENVRLNDIPKLSAVYEGILVRLLAGNAVEGGSHHHHHH