CATH Domain: 1vgmA02 XML data for domain: 1vgmA02

Molscript image for 1vgmA02
1vgmA02
PDB coordinates for domain 1vgmA02

PDB 1vgm, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.230 Cytochrome p450-Terp; domain 2
1.10.230.10 Cytochrome P450-Terp, domain 2 Gene3D
1.10.230.10.4
1.10.230.10.4.1
1.10.230.10.4.1.1
1.10.230.10.4.1.1.1
1.10.230.10.4.1.1.1.1

[top]
Segment boundaries for domain 1vgmA02

Chopping figure for domain 1vgmA02
DomainStart PDB ResidueStop PDB Residue
1vgmA01 15 220
1vgmA01 325 358
1vgmA02 221 324

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1vgmA02
GAAEEAFKQFVEIGSVENADKWFEEKIIKGKSRLMGFGHRVYKTYDPRAKIFKTLAKSFAEKNENVKKYYEIAERIEKLG
VDTFGSKHIYPNTDFYSGIVFYAL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vgmA02
GAAEEAFKQFVEIGSVENADKWFEEKIIKGKSRLMGFGHRVYKTYDPRAKIFKTLAKSFAEKNENVKKYYEIAERIEKLG
VDTFGSKHIYPNTDFYSGIVFYAL
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by auto on 14 Aug 2007 22:56

Assigning to "1.10.230.10" based on similarity with "1vgmB02"

Flow stage update by auto on 14 Aug 2007 22:46

No in_process hits for Domain "1vgmA02" ready to be processed

Flow stage update by auto on 19 Jul 2007 10:57

Domain "1vgmA02" hits Domain "1vgmB02" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Jul 2007 10:57

NW result present for Domain "1vgmA02"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "1vgmA02"

Flow stage update by auto on 14 Jul 2007 06:01

Beginning processing for Domain "1vgmA02"

Insertion by auto on 14 Jul 2007 04:20

Final ChopClose added based on similarity with "1vgmB"