CATH Domain: 1vfsB01 XML data for domain: 1vfsB01

Molscript image for 1vfsB01
1vfsB01
PDB coordinates for domain 1vfsB01

PDB 1vfs, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.37 Lyase, Ornithine Decarboxylase; Chain A, domain 1
2.40.37.10 Lyase, Ornithine Decarboxylase; Chain A, domain 1 Gene3D
2.40.37.10.4
2.40.37.10.4.1
2.40.37.10.4.1.1
2.40.37.10.4.1.1.1
2.40.37.10.4.1.1.1.1

[top]
Segment boundaries for domain 1vfsB01

Chopping figure for domain 1vfsB01
DomainStart PDB ResidueStop PDB Residue
1vfsB01 1003 1013
1vfsB01 1249 1384
1vfsB02 1014 1229

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|1vfsB01
ETPTRVYAEIDAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGRIA
MDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1vfsB01
MNETPTRVYAEIDAMTLRASLALVKTVPAGHGVSYGHHYVTESETHLALVPAGYADGIPRNASGRGPVLVAGKIRRAAGR
IAMDQFVVDLGEDLAEAGDEAVILGDAERGEPTAEDWAQAAHTIAYEIVTRIGGRVPRVYLGGLEHHHHHH
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 26 Aug 2007 06:27

Assigning to "2.40.37.10" based on similarity with "1vfhA01"

Flow stage update by auto on 26 Aug 2007 06:20

No in_process hits for Domain "1vfsB01" ready to be processed

Update comment by auto on 26 Aug 2007 02:13

Domain "1vfsB01" hits Domain "1vfsA01" (100% over 100%) which is currently in process

Flow stage update by auto on 26 Aug 2007 02:08

Domain "1vfsB01" hits Domain "1vfsA01" (100% over 100%) which is currently in process

Flow stage update by auto on 26 Aug 2007 02:08

NW result present for Domain "1vfsB01"

Flow stage update by auto on 22 Aug 2007 10:08

All required files are present for Domain "1vfsB01"

Flow stage update by auto on 21 Aug 2007 17:49

Beginning processing for Domain "1vfsB01"

Insertion by auto on 21 Aug 2007 16:04

Final ChopClose added based on similarity with "1vfhA"